SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087189 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087189
Domain Number 1 Region: 23-110
Classification Level Classification E-value
Superfamily RING/U-box 1.69e-33
Family RING finger domain, C3HC4 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087189   Gene: FBgn0044020   Transcript: FBtr0088085
Sequence length 113
Comment pep:known chromosome:BDGP5:2R:7540261:7566857:-1 gene:FBgn0044020 transcript:FBtr0088085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDPENSVDRPTDDGDAGKPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQ
ADNKRDVMGRQDCVVVWGECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMGK
Download sequence
Identical sequences B4P623 Q7JWH5
FBpp0087189 FBpp0291421 7227.FBpp0087189 7245.FBpp0258518 NP_001163119.1.81976 NP_610691.1.81976 XP_002091186.1.41174 FBpp0087189 FBpp0291421 FBpp0258518 FBpp0087189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]