SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087193 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087193
Domain Number 1 Region: 2883-2997
Classification Level Classification E-value
Superfamily Bromodomain 7.33e-35
Family Bromodomain 0.00016
Further Details:      
 
Domain Number 2 Region: 2493-2557
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000062
Family PHD domain 0.0027
Further Details:      
 
Domain Number 3 Region: 2559-2616
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000642
Family PHD domain 0.0052
Further Details:      
 
Domain Number 4 Region: 950-1025
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000154
Family Methyl-CpG-binding domain, MBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087193   Gene: FBgn0033636   Transcript: FBtr0088091
Sequence length 2999
Comment pep:known chromosome:BDGP5:2R:7466385:7503550:-1 gene:FBgn0033636 transcript:FBtr0088091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKNAGDGSDGKNSNKNSNAGGGGGAGGPHDPTGLLDAASLFAYWGRDPTGAAAAAASNP
LFNSQFNAAAAAGLGLLPQAGGASANDRYSMAAAAAAAAGAHHHQNTMAVAASQAASLAG
LHPASWWSMAQLAAQDYFSRLQASGLSPFPHPDLAAAFGPAGMGMGGGAGGAGAGGGGAG
VLGQGGGGNGGSGNGGGGSSSGSSGSKSNKSRKEKRAAQQQQQQQQNLANSLNAAAAAAA
AAAANNPAAALASMHGFGVGVPGTSIPSVSTGSGSISTNSGGHGSYKSTASAYGKPSTMT
SSSMANNPGSAYDPVTLHKELLAMQAVAAAASGSGSSGSSGKKSGGGGSSSSSMHSLGMG
IGGSGGMMSSGKASTSVSASNSSLGGMHPSLTSSNPLMSPHAGMGSSSSSSSKDRDKNNP
SLNALNSLSQFGALGMTPQQSMQAAMNAFAASTGVSPSATVTSSPHHSSQQQQQMGGNSS
TSGSGKSSSKDYMMGTGSEHPSLLGVRLPPDTEIIKYTSSIVGPKIPGTTSRGRKKTISE
TEQQTTQQQQKQQHQAEQHLLQQQQQAQKELDSTKNAISSLLAFPGLSPAKRARLEMEYA
AMAAAAQQQHQQAQQQHQAQQQLHGMLGAAGIPGMAGLVGLPGMSGNPLDQLSVSKASSS
TAPTTSTSSSSAGSNLLNQSNSDRVEVIKLPPTITSNGAYNLSSKGKEVHDLTTDMATNS
GGVNLSLKSNAGSSALTPSGAVGSASNPITIDDFDAPLNLSMKPSDKSNSSSSNAAAGGS
SSSSAALANLASDYQAASSGQSGNSLQSLSSITAALGGTGGMPGGSISGSGGTSPAPAGA
GSGATGGGSGSGGSGGGSSSYKEGRPRNLGRGVSKPKKNTVASLLAQSRAVGLKPMLATQ
QLLQQGADIEKIRLALSEANAHMETSTDSESVAAESGLSESESEDANILNVAELRVPLEL
GWKRETVIRGLTKQGQIRGEVTYYAPGSTTPLKSNGQVFAILEQQPSNLSRENFSFSARA
IVGSFLQPAPPPYANDGEYIRMTDEDVAKRLEDLKVFTRQTLNVEQRIEIAKQQQAMRDA
KKLQKEELARNKEKARQEKNSKLEQQRKDKELKNQQAVEERKKRQEELDRLKQEELLKKQ
QEKEKRRQEAILAKEQELQKQKEMLLAAEMERERRRQHMSLIRMLELRRKFEDREKKKHQ
LVLDRLLLRERRMAERKRDAEILQLIRRPNEDSEMPQELVIPELDRIAGNRLPGQAMADL
LMVFEFLHNFGETLGFDMESLPSLQNLHDALMSDSNADAEEELLSVMTHLLVCAIEDPGV
PNPGRHTTLLGQSLRNADITNSNVSEILRIYLYATATGEVRQMHGITVDRERERRVPDHH
QLDSDTTTHSHSVKNQEYYKLLHENDTWKLSQSLKDRPFVALNPTRKAQMLAHLCNDLLM
NKAVLRQIDGSLETCAQMRKEKYMTDMKVRKYKALHMRKARIEAYERAQAEREAAMQALM
AQQKLDAERLKAEEEAKAAAAEEAAAAAGTDGEATKGGSPNGEKPEDGDQNEEGAAKEPQ
QQQQQPMEVDGVVDEASLVSPAKTIIQTDNSLTPSKQDMPTPTYQINGSSTPTTSGVTGG
DMNVLLQAKKSGARNSINDEHHHDVSIIDDDLSDLDSEITNVEEDEDNRLSADELQKKLD
KIVRASLNCKEALEKSTNQLRAACFGQDRFWRRYWKLPKAGGIFIEALESAQNDICDYHE
ALEAMDDKKDANDEKENSENEKDVAAESSEQPMEVDESITKLEDGVPASDVGMPESNQQN
AHQDEEDDDDDVTEINKVEPEIVDLGDDDDDAAPPLPKIEPPRPEIKVKSEMELMGPPPT
TMISTKTDFEAEIKIPSMPGILMPPTLNNNNTNNNNNNNGSDNCDKLETGLGLGQQQQNF
SQSVIKTEDVKKEDDCIIVSTSSVDDTPKWFSIVRREVPLISELPAEEGGVVGQELQISY
ANQNCSAQLQLQGHPWDLINNMQYYSIPMDECKVDTSKLGNECIFSLSGLDEKQMLAKVE
EYKAHKVESKNGLGSPHRHHETKDDEEQAKLKLDKEIDTEMETDADDLAGKEKFFRLRSD
VPPDTGGGVSEGTDVKPKIELRLDEALSQAYYHNIANMSLSSVQTYIPIDIPLPLSMTPD
EHRLLEQVKLAGFPERVHGVYVPRRQRYGWWQLDDEQKLRQLLKTLNPSGLRERELQENL
QRFLGLEQPLGVNYKLKSDIDFPEEFLMPDKKGDWNPKVAKRVELALIEQLESLEDKVAS
ASMQLKNWQLPNRVESELTLDSQEDVTEEDFVSIIPMIRERIIDLEANIERRYLKPPLGS
QTGDAHLAVIAQNQHTTTQTQNSASAAAYLLQMQQQQQQQQLAQQQQQQQQGSGAGNSLN
PSSFNERTMALAAAAAASGPGNATGVANSAVVAGATPCESGSGEPNSGNASPASNCDSDR
DEKVEQIPKGLVQWRDAVSRSHTTAQLAMALYVLESCVAWDKSIMKANCQFCTSGENEDK
LLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYECVNKATNERKCIVCGGHRPSPVGKMIYC
DLCPRAYHADCYIPPLLKVPRGKWYCHGCISRAPPPKKRSAGGTSGSSSKSRRDRDRESG
GSAKRRSDNSKTPAMEHMQQQQMPLAGGDSHHHHHQQPPSLNSSHDESMNSLPAAPLSPA
HSVVSATNYDDQHHANNSVDGSSRFHAHLIPPSNNGTAALLEDVPGGANVMPGVYPVYTP
VAAGNFSAGLINQAPVQPAMPFANVVAMSPRAVTPTRTRTPTPTPAPTPPPPPPTPLLMQ
ASPTATALHVNACQSPPQQQHAQLMTMPSPPAIGVGTATNQMSPPPINIHAIQEAKEKLK
QEKKEKHATKKLMKELAVCKTLLGEMELHEDSWPFLLPVNTKQFPTYRKIIKTPMDLSTI
KKKLQDLSYKTREDFCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFESRWGELTDKHS
Download sequence
Identical sequences A1Z8M2
FBpp0087193 NP_523701.3.81976 FBpp0087193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]