SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087232 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087232
Domain Number 1 Region: 237-285,462-535
Classification Level Classification E-value
Superfamily SET domain 3.76e-18
Family Viral histone H3 Lysine 27 Methyltransferase 0.027
Further Details:      
 
Domain Number 2 Region: 74-183,598-628
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000111
Family Tetratricopeptide repeat (TPR) 0.0047
Further Details:      
 
Domain Number 3 Region: 277-326
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000153
Family MYND zinc finger 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087232   Gene: FBgn0033633   Transcript: FBtr0088133
Sequence length 660
Comment pep:known chromosome:BDGP5:2R:7293191:7295584:1 gene:FBgn0033633 transcript:FBtr0088133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTPLSQKTGFFAEYYLKLKDQAGPNCESDIAKLSACKSDEERVAYVEKLPWVQAGDANL
VVNQEFAGKNASLAAEIKERATSAFKAKKWLEAMMLYTRSYVALPSENVAEIRVVLANRS
ATLYHMQKYQECLIDIKRALDLSYSKDLIYKLYERQARCYMALKDYPHTIDSFKKCITAM
DDSTLASDKRAKLNLDAMTMIKMLQNDPRTAKQEAKQQKQKIALDQAKPVKLENEFVSPL
VRIDSNRQEGRFARASADVKPGEELLVERPFVSVLLEKFAKTHCENCFMRTVVPVACPRC
ADVLYCSEQCREEASKKYHKYECGIVPIIWRSGASINNHIALRIIASKPLDYFLKLKPTI
DEELTPEQLISLPKDDFRRVAQLERHQGERQPSNFFQHVLMARFLTNCLRAGGYFGSEPK
PDEVSIICSLVLRSLQFIQFNTHEVAELHKFSSSGREKSIFIGGAIYPTLALFNHSCDPG
VVRYFRGTTIHINSVRPIEAGLPINENYGPMYTQDERSERQARLKDLYWFECSCDACIDN
WPKFDDLPRDVIRFRCDAPNNCSAVIEVPPSCNDFMVKCVTCGEITNILKGLKVMQDTEM
MTRTAKRLYETGEYPKALAKFVDLIRIMYEVLAPPFPDFCESQQHLKDCFLNLGNVYTLD
Download sequence
Identical sequences A1Z8L3
7227.FBpp0087232 FBpp0087232 FBpp0087232 FBpp0087232 NP_725048.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]