SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087233 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087233
Domain Number 1 Region: 144-192,369-442
Classification Level Classification E-value
Superfamily SET domain 1.64e-18
Family Viral histone H3 Lysine 27 Methyltransferase 0.027
Further Details:      
 
Domain Number 2 Region: 18-98,498-536
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000607
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number 3 Region: 184-233
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000126
Family MYND zinc finger 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087233   Gene: FBgn0033633   Transcript: FBtr0088134
Sequence length 567
Comment pep:known chromosome:BDGP5:2R:7293216:7295584:1 gene:FBgn0033633 transcript:FBtr0088134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLYTRSYVALPSENVAEIRVVLANRSATLYHMQKYQECLIDIKRALDLSYSKDLIYKLY
ERQARCYMALKDYPHTIDSFKKCITAMDDSTLASDKRAKLNLDAMTMIKMLQNDPRTAKQ
EAKQQKQKIALDQAKPVKLENEFVSPLVRIDSNRQEGRFARASADVKPGEELLVERPFVS
VLLEKFAKTHCENCFMRTVVPVACPRCADVLYCSEQCREEASKKYHKYECGIVPIIWRSG
ASINNHIALRIIASKPLDYFLKLKPTIDEELTPEQLISLPKDDFRRVAQLERHQGERQPS
NFFQHVLMARFLTNCLRAGGYFGSEPKPDEVSIICSLVLRSLQFIQFNTHEVAELHKFSS
SGREKSIFIGGAIYPTLALFNHSCDPGVVRYFRGTTIHINSVRPIEAGLPINENYGPMYT
QDERSERQARLKDLYWFECSCDACIDNWPKFDDLPRDVIRFRCDAPNNCSAVIEVPPSCN
DFMVKCVTCGEITNILKGLKVMQDTEMMTRTAKRLYETGEYPKALAKFVDLIRIMYEVLA
PPFPDFCESQQHLKDCFLNLGNVYTLD
Download sequence
Identical sequences Q95RZ8
FBpp0087233 FBpp0087233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]