SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087350 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087350
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000805
Family RING finger domain, C3HC4 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087350   Gene: FBgn0024956   Transcript: FBtr0088255
Sequence length 320
Comment pep:known chromosome:BDGP5:2R:6626122:6627339:-1 gene:FBgn0024956 transcript:FBtr0088255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDQACPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFLKGSGACPECMVPLRRNNFRV
QLFEDPMVEKEVDIRRRILRDYNKREEDFASLAEYNDYLEEIEDIVYNLCNNIDIIETNK
RIEAYKRDNREVIQRNKTRVGRDEYALEEMLELEKVQEEARRKELEELENEHKKKKARDK
QALIEELMYSGKDAAQIVTEFAEKAEKQREEEKQLPPPKPANEFSTGIKFGQTADPSLLP
VPKSEEGPLFVYEPLVPFSEGPAMPPTNEIVSRGYIAHIRAETPQENAGGFTSALACERA
LQEALQGLYYTATTGVVSGT
Download sequence
Identical sequences Q7KPG8
7227.FBpp0087350 FBpp0087350 FBpp0087350 FBpp0087350 NP_610605.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]