SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087363 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087363
Domain Number 1 Region: 32-57,175-352
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.69e-61
Family G proteins 0.000000144
Further Details:      
 
Domain Number 2 Region: 61-182
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 5.1e-43
Family Transducin (alpha subunit), insertion domain 0.000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087363   Gene: FBgn0001122   Transcript: FBtr0088268
Sequence length 354
Comment pep:known chromosome:BDGP5:2R:6325753:6350191:1 gene:FBgn0001122 transcript:FBtr0088268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESG
FTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPF
SEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRV
KTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDET
TNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEA
AAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Download sequence
Identical sequences B3N6D7 B4NXN6 B4QID9
FBpp0264373 FBpp0142715 FBpp0209144 7227.FBpp0087364 7245.FBpp0264373 FBpp0087359 FBpp0087362 FBpp0087363 FBpp0087364 FBpp0087365 FBpp0089315 FBpp0087360 FBpp0087359 FBpp0087362 FBpp0087363 FBpp0087364 FBpp0087365 FBpp0089315 NP_724934.1.81976 NP_788304.1.81976 NP_788305.1.81976 NP_788306.1.81976 NP_788307.1.81976 NP_995802.1.81976 XP_001969047.1.56816 XP_002089949.1.41174 XP_015015076.1.56816 XP_015054139.1.41174 XP_016026892.1.80810 XP_016026894.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]