SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087638 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087638
Domain Number 1 Region: 33-181
Classification Level Classification E-value
Superfamily L domain-like 2.52e-33
Family Internalin LRR domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087638   Gene: FBgn0033408   Transcript: FBtr0088555
Sequence length 188
Comment pep:known chromosome:BDGP5:2R:5282834:5283602:-1 gene:FBgn0033408 transcript:FBtr0088555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMI
EKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVL
YISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPV
VLNEEPQL
Download sequence
Identical sequences A1Z7U2 B3N7H4 B4HSR7 B4P414 B4QH84
FBpp0087638 FBpp0087638 7227.FBpp0087638 7245.FBpp0267345 FBpp0087638 FBpp0129106 FBpp0202083 FBpp0208481 NP_610483.1.81976 XP_001970320.1.56816 XP_002033081.1.34323 XP_002089785.1.41174 XP_016026674.1.80810 FBpp0267345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]