SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087653 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087653
Domain Number 1 Region: 41-101
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000000824
Family SAP domain 0.0028
Further Details:      
 
Weak hits

Sequence:  FBpp0087653
Domain Number - Region: 366-433
Classification Level Classification E-value
Superfamily RING/U-box 0.00706
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087653   Gene: FBgn0003612   Transcript: FBtr0088572
Sequence length 601
Comment pep:known chromosome:BDGP5:2R:5003631:5007610:1 gene:FBgn0003612 transcript:FBtr0088572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKTRSQTARTQAENAATSSSPGHQSTSSAPIAVNPFDSTKYKECEQMVQMLRVVELQKI
LSFLNISFAGRKTDLQSRILSFLRTNLELLAPKVQEVYAQSVQEQNATLQYIDPTRMYSH
IQLPPTVQPNPVGLVGSGQGVQVPGGQMNVVGGAPFLHTHSINSQLPIHPDVRLKKLAFY
DVLGTLIKPSTLVPRNTQRVQEVPFYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFC
LVETSCDQEDCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPVNVTSNVKLSPTVT
NTITVQWCPDYTRSYCLAVYLVKKLTSTQLLQRMKTKGVKPADYTRGLIKEKLTEDADCE
IATTMLKVSLNCPLGKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWNCPVCDKPAIY
DNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSWSTPGLRSETQILDTPSKPAQKVEVISD
DIELISDDAKPVKRDLSPAQDEQPTSTSNSETVDLTLSDSDDDMPLAKRRPPAKQAVASS
TSNGSGGGQRAYTPAQQPQQSGGNVFKKPQKAEELYKRVHLGVWLRPRKPKPESSRRPNV
G
Download sequence
Identical sequences Q8IGK3
FBpp0087653 FBpp0087653 NP_724750.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]