SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087656 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087656
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily SAP domain 0.0000000000000044
Family SAP domain 0.0028
Further Details:      
 
Weak hits

Sequence:  FBpp0087656
Domain Number - Region: 330-397
Classification Level Classification E-value
Superfamily RING/U-box 0.00706
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087656   Gene: FBgn0003612   Transcript: FBtr0088575
Sequence length 604
Comment pep:known chromosome:BDGP5:2R:5004092:5008321:1 gene:FBgn0003612 transcript:FBtr0088575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFPSLQECEQMVQMLRVVELQKILSFLNISFAGRKTDLQSRILSFLRTNLELLAPKVQE
VYAQSVQEQNATLQYIDPTRMYSHIQLPPTVQPNPVGLVGSGQGVQVPGGQMNVVGGAPF
LHTHSINSQLPIHPDVRLKKLAFYDVLGTLIKPSTLVPRNTQRVQEVPFYFTLTPQQATE
IASNRDIRNSSKVEHAIQVQLRFCLVETSCDQEDCFPPNVNVKVNNKLCQLPNVIPTNRP
NVEPKRPPRPVNVTSNVKLSPTVTNTITVQWCPDYTRSYCLAVYLVKKLTSTQLLQRMKT
KGVKPADYTRGLIKEKLTEDADCEIATTMLKVSLNCPLGKMKMLLPCRASTCSHLQCFDA
SLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSWSTP
GLRSETQILDTPSKPAQKVEVISDDIELISDDAKPVKRDLSPAQDEQPTSTSNSETVDLT
LSDSDDDMPLAKRRPPAKQAVASSTSNGSGGGQRAYTPAQQPQQSESPEQQASRQSPEKQ
TVSEQQLQQQQHEQPATAAVHASLLESLAAAVADQKHFQLLDLAAVAAAAAATASSGQSQ
NAGP
Download sequence
Identical sequences A1Z7P8
FBpp0087656 FBpp0087656 NP_724752.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]