SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087658 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087658
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000366
Family SAP domain 0.0037
Further Details:      
 
Weak hits

Sequence:  FBpp0087658
Domain Number - Region: 319-386
Classification Level Classification E-value
Superfamily RING/U-box 0.00656
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087658   Gene: FBgn0003612   Transcript: FBtr0088577
Sequence length 593
Comment pep:known chromosome:BDGP5:2R:5004125:5008321:1 gene:FBgn0003612 transcript:FBtr0088577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQMLRVVELQKILSFLNISFAGRKTDLQSRILSFLRTNLELLAPKVQEVYAQSVQEQNA
TLQYIDPTRMYSHIQLPPTVQPNPVGLVGSGQGVQVPGGQMNVVGGAPFLHTHSINSQLP
IHPDVRLKKLAFYDVLGTLIKPSTLVPRNTQRVQEVPFYFTLTPQQATEIASNRDIRNSS
KVEHAIQVQLRFCLVETSCDQEDCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPV
NVTSNVKLSPTVTNTITVQWCPDYTRSYCLAVYLVKKLTSTQLLQRMKTKGVKPADYTRG
LIKEKLTEDADCEIATTMLKVSLNCPLGKMKMLLPCRASTCSHLQCFDASLYLQMNERKP
TWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSWSTPGLRSETQILDT
PSKPAQKVEVISDDIELISDDAKPVKRDLSPAQDEQPTSTSNSETVDLTLSDSDDDMPLA
KRRPPAKQAVASSTSNGSGGGQRAYTPAQQPQQSESPEQQASRQSPEKQTVSEQQLQQQQ
HEQPATAAVHASLLESLAAAVADQKHFQLLDLAAVAAAAAATASSGQSQNAGP
Download sequence
Identical sequences A1Z7Q1
FBpp0087658 FBpp0087658 NP_724755.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]