SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087688 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087688
Domain Number 1 Region: 830-903
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-16
Family Complement control module/SCR domain 0.0006
Further Details:      
 
Domain Number 2 Region: 713-776
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 3 Region: 893-953
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000715
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 794-841
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000139
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 5 Region: 627-699
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000115
Family I set domains 0.061
Further Details:      
 
Weak hits

Sequence:  FBpp0087688
Domain Number - Region: 558-598
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00148
Family Complement control module/SCR domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087688   Gene: FBgn0010114   Transcript: FBtr0088607
Sequence length 958
Comment pep:known chromosome:BDGP5:2R:5115288:5134752:-1 gene:FBgn0010114 transcript:FBtr0088607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSRQRMRHKPLWALISLTVLLLVLDKSNANTEPVETSTTSEPDASPGCRAPDVRFTIVK
PEATTEQPLAKFETTQIYLPEDFTTADVEFVDSVPRHPNENHAAVINPYSLDLGDDHLHV
GDAAASLVGDDDLGDEDEDHHGDPEDKRLNANRKQGKRRRAGSGRRRRIENENGQTGRGR
GSRYKRHAILHDTEASPETDRWAGSKLAAEGDVYYVHIADILKSREPNRELKSKLHKLKM
KARLNKCLAEGGKEKCTRLLKKKPKKKVVEKEQTLKKEKKFPKEEQSKEKVPENGQTPKE
DELELDHPETAAAHHRRRGDSHAAELDQRDRSPRWRRRRSTEFKGDLGQLPPESGIGPEP
EPLADQDLKDLQQYGNQSSSARVALLWQRVKRKSGKTTGALSRPKGGGDSSSKTTSRKDK
GIYDEEAGYTPIHPDDPEFDEEEEEDEEVDILQQFTEVSEIRFPGEIGPMGDRRLCKIRC
VKGKWVGPLCATNEEDDNGNVKFQPLYKSCHVNRIPSHLLLSYRNISVTPIPPNRGWRKT
RLSKSTLLSNTEINVGWDLPHGHSLQARCQELGIYKLLGESRVLCSNGLWAPRMPSCVPT
TVLTNYSEDSAPSIRIKIFNGSHSFEPSGVMAVPPHSTVLMDCMYPRVRGTPEWSWTSWY
MQYSTGWSPAQEEKAVRYRLSIKNIENNDSGTFTCTSPRGLTNSIAVVVATSTCPQLTEP
LAPLKLRLEGNKLGQRAHYECPEGFRLDGAWNATCLASGNWSSPTPTCHAIQCPRLELDD
PHLSLIELNTSAWGRAVFKCQWGFKLTGPAQLDCEPSGVWSGPVPRCKVIQCVMPVAPLN
GRIGGTSLSQRRLTVGALVTFSCNDGHSLVGESSIICTENGQWSHSPPFCKSQCPYPGDP
PNGLIAPLKFNYDAGDYLSVQCRPGFVQSYEGPPERPKCQPDGRWSGPMPKCKSYEEV
Download sequence
Identical sequences Q09101
NP_724773.1.81976 FBpp0087688 FBpp0087688 FBpp0087687 7227.FBpp0087688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]