SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087714 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087714
Domain Number 1 Region: 84-196,236-293
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.02e-26
Family NAD kinase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087714   Gene: FBgn0033373   Transcript: FBtr0088633
Sequence length 413
Comment pep:known chromosome:BDGP5:2R:4977279:4980474:-1 gene:FBgn0033373 transcript:FBtr0088633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKSKQLLQQFSKEYAKYTPTNFKLKRALVVTKLSRYEFEQLRHPELSPDQLQQKLRDRG
TDVEMVLHLHKVHKDFERRVVQSFQDVGCEVKLSSRLEFRSSLSKDVMSWADVIVPVGGD
GTFLLSAGRASPLFALSQQKTPIVGFNSDPLHSEGRLMLPKHYSDNPADAVSRIKSGDFK
WMHRSRVRTTMLGSNGNIPEPTDLFRHTEVKMEQVSTAPEMLDQDMAYKYKAKMKRVLPY
LALNEVFIGEHLSARVSHLQLVLDHQDVVNKTKCSGLCVSTGTGSTSWHTSINRITSRDV
DDLLRSLPDGDSKNVMMLRQNAEEIAQRYNQGLLFAPDDPRLCYSIREQICVGVWPSPKT
FKERDFVQTVFVKSHCIDANLVIDGSISFPFNDGAKALLEVHPEDALLTIALD
Download sequence
Identical sequences Q7JW73
FBpp0087714 NP_788288.1.81976 FBpp0087714 FBpp0087714 7227.FBpp0087714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]