SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087806 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087806
Domain Number 1 Region: 95-119
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000209
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087806   Gene: FBgn0033317   Transcript: FBtr0088727
Sequence length 404
Comment pep:known chromosome:BDGP5:2R:4517699:4519467:-1 gene:FBgn0033317 transcript:FBtr0088727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKAPPGPSKKTEQKKKEKVIEDKTFGLKNKKGNKQQKFIQQVQKQVQSGGQHPRQDG
DKRKEEKEKKLAEQREMALIFKPVQTQKVEKGTDPKSVVCAFFKQGTCTKGDKCKFSHDL
SQENKVEKRSIYVDMRDEDDPMTNWDDAKLKEVVEKKSSGEKQRPTTDIICKFFLEAVEK
SKYGWFWECPNGGKCIYRHALPAGYVLKRDKKKEEKPTEISLVDLIEKERAALGPNQTRV
TLESFLAWKKRKIAEKKAKLAAEEERKKSDFSKGKQFGISGREMFSFNPDLVDDGPMEEG
DAAFDVYNREDDDDNAVEFKELDLAALSLAAKEVDGSGTIASTNRLLDQATEAAKTAAAE
DAAADEDGPSSSAPANDAAPINKDLFVDLAGELDDLDLDDEDDD
Download sequence
Identical sequences A0A0B4LEV3 Q7JWR9
7227.FBpp0087806 FBpp0087806 FBpp0087806 FBpp0087806 NP_001286202.1.81976 NP_610401.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]