SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087866 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087866
Domain Number 1 Region: 44-230
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.38e-38
Family Ankyrin repeat 0.0003
Further Details:      
 
Domain Number 2 Region: 263-327
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000178
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087866   Gene: FBgn0033273   Transcript: FBtr0088789
Sequence length 461
Comment pep:known chromosome:BDGP5:2R:4055453:4057594:1 gene:FBgn0033273 transcript:FBtr0088789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSNLCKYGPPPDSDSDSSYDGFYFSDKVKRSKPAPYVDPEQKLYDAVVAGDLKTMQEEM
RKLVLQVDQPVKGGLNLLMLACREGHYKIVEWLLERAGANVNRQLDSLMPLMMACNTTHK
DPCLAERIVGLLLRHGAVINVSEKYGMTPFMFACQNGFAGVVRLLIKDASFDAVDNQGCT
AIFHAIEKNHVEVVKLLVEAGANATIANNKGYTPTQVAECHGYYDLLEILPRPASTYLVP
THFLGYNTLRDHIPRIFLKSDCPEYFQELNGILEAINIGNMVQYFAIARISLADFLVMDE
QSLREIGIEYPIFRHKILTGILDFHLHHWSNSSIARVKKDEMNNFYEILLITASHLQHLV
IIQASLRFILKNQEHNKMGQPSEMQVAAMKSNLQGYRDVLNQITKTVKYLGSFSPSQNPL
FIDFNEILAERKRKKVRSYFKYTTIILGISVFICLKCKWFS
Download sequence
Identical sequences Q7K5K0
FBpp0087866 NP_610362.1.81976 7227.FBpp0087866 FBpp0087866 FR810 FBpp0087866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]