SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088092 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088092
Domain Number 1 Region: 610-715
Classification Level Classification E-value
Superfamily Bromodomain 2.22e-31
Family Bromodomain 0.0004
Further Details:      
 
Domain Number 2 Region: 276-348
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.73e-18
Family PHD domain 0.0086
Further Details:      
 
Domain Number 3 Region: 1303-1410
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000241
Family PWWP domain 0.017
Further Details:      
 
Weak hits

Sequence:  FBpp0088092
Domain Number - Region: 391-425
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00266
Family PHD domain 0.02
Further Details:      
 
Domain Number - Region: 22-47
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0148
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088092   Gene: FBgn0033155   Transcript: FBtr0089021
Sequence length 1430
Comment pep:known chromosome:BDGP5:2R:3160037:3165580:-1 gene:FBgn0033155 transcript:FBtr0089021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLDFDAVEYCKGVKTQQSQPPFACPVRGCDRSYKTIMGLQYHLMKYDHDNPQPLTPVLT
PSRKKARSRSGGHHSTPRPHKDHPTPGGGGAEARNGCSSASAGGGSASGVSARQYANPES
LVSYNEEEATVTFNLDGKSVRLGIDDALPLVEDEEFAALVARGCILNADAPPLEENAPWA
RVQVPVARVAEIPDYRVSDAPPRPLAYYRFIEKSLEELDGEVEYDVDEEDSAWLEHMNEE
RQRLGLNAVGIDTMELLMDRLEKESHFQAAANGTPTGVEVDDDAVCCICLDGECQNTNVI
LFCDMCNLAVHQDCYGVPYIPEGQWLCRRCLQSPSKPVNCVLCPNAGGAFKQTDHGQWAH
VVCALWIPEVRFANTVFLEPIDSIETIPPARWRLTCYVCKEKGLGACIQCHRNSCYAAFH
VTCAQQAGLYMTMDTVKDGHNDSSMHVQKFAYCHAHTPADAKLKMNVPDFEDTRHKMKEA
RKALAKKRSTAPVVLIPTIPPDRVQEIATMVTMQRKKEFLDRIIAYWTLKRHYRNGVPLL
RRLQSQGNNHGVIQRNGIEGSPDTGELYRQLKYWQCLRQDLERARLLCELVRKREKLKVA
FVRISEEVVMLQLNPLEAALNKLLDALEARDSMQIFREPVDTSEVPDYTDIVKQPMDLGT
MRAKLKECQYNSLEQLEADFDLMIQNCLAYNNKDTVFYRAGIRMRDQAAPLFVQVRKELQ
RDGLLARSQRYHVDHVEAEVEQELRLLLAAPASEGIVQKLLILADKSQVLKNPTYRTKKI
KQIRLEISRMRKSLQKARFAARHSSHANQSQSDDEDTLGGSPSKKRTRKRFNSSGVDMEL
GHDDDDEEEDSDEDSMGEDTVSKDLLNSTQTPPCSPIKSLNNSSSPVGINRRTAILLTRK
AQAALKRPSEPLTTPVKEEQHNSQSSNTQSTSGSSSSVTTAATAASSGAGTLNHVLSSAP
PTASSFALTQNNSSGGGALASGTGIGGSSSAGTAAAASLTSTALAMNSKLSANLPVKSPK
RPGRYRRVPEVRHSSSMSPKKSPNPAVTVSQALPMPETLPFERIPDSFRVYRANNQRDVS
DSDDAPSQSSSPCSSCSDFSMSGSCSDFDSDEASEGDADGDPDRDGGRSRSEERDSTSQE
GTTDAMDMQHASLNNVQGNNGNMAISSSSGGSGGSSSEDDELEERPLSARQNKPMKVGTR
GTPTPTTMARAVALSAGRGRGKRRSNLSESTSSTATPPPLRRAGKLRSATPNASPLVNNI
KARRNTTAAGSAPLTNNNRSKHSEDSASSERHNNHSHGQKPALEPLQLVWAKCRGYPWYP
ALILDPKTPKGFVYNGVPLPAPPTDVLALRKNCLDEIVFLVLFFDVKRTWQWLPANKLDI
LGIDKQLDQQKLVESRKPAERKAVKKAYQDALHYQSQVSDLEGQGPDPIM
Download sequence
Identical sequences Q7JVP4
FBpp0088092 7227.FBpp0088092 FBpp0088092 FBpp0088092 NP_001286155.1.81976 NP_610266.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]