SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088152 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088152
Domain Number 1 Region: 684-967
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.79e-81
Family Protein kinases, catalytic subunit 0.00000000537
Further Details:      
 
Domain Number 2 Region: 52-226
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-47
Family Ephrin receptor ligand binding domain 0.0000312
Further Details:      
 
Domain Number 3 Region: 353-593
Classification Level Classification E-value
Superfamily Fibronectin type III 3.86e-26
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 4 Region: 986-1043
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000216
Family SAM (sterile alpha motif) domain 0.0026
Further Details:      
 
Domain Number 5 Region: 254-353,402-412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000127
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088152   Gene: FBgn0025936   Transcript: FBtr0089083
Sequence length 1047
Comment pep:known chromosome:BDGP5:4:631310:641552:1 gene:FBgn0025936 transcript:FBtr0089083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKSALKSAFYKNQAPISEQNRSQIVSRMSLLRTILLIIISIHFKLAHADQVVLLDTTRE
ATLEWTRYPYGPQAQTPGWVEESFTDFVKGINWRSYVVCDVAYHNVNNWLWSPFIDRGSA
NRLYIEIQFTIRDCSLFPGNALSCKETFSLLFYEFDAATREPPPWQTDSYRLIARIAAGE
GRFNQNSDVDINTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAVTENFAHFNE
TPTGREITIIEKQNGTCVDNAEPYETPTYLCKGDGKWTILTGGCRCKAGYEPNYTNKTCT
ECPLGTFKSPEVTKCTPCPPNSNASKTGSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNL
TLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNICSPNVVYNPSTDTFNE
TKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSNESSLVAVSDIVFSNTSLLNIPLDLN
EVKTGQAEIVFTTESVLLSTVFNLRILAITNKDADLEWDKPVQSDFPLEFYEVRWFPKVE
LDAINKSALNTKETKAHIVGLLENTEYGFQVRCKTNNGFGSYSNMIYAQTLQSVGSVYDD
SVQIRFIAGAIVTGVLFLVIFIIATVYFMRSKHQDDLDKKSTNHLPLPLDYASNEVTTPL
FGNSRSYVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQD
IDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSL
DTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGL
SREIENASDAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNW
SNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSL
LTTRPSPESDGNHILDGQRGQNIFISTDLWLEHIKMSRYCHHFKEANLINAQQISRLTAQ
QLSDMGITLVGHQKKILHQARQLDTII
Download sequence
Identical sequences Q8IMC2
FBpp0088152 FBpp0088152 NP_726591.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]