SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088192 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088192
Domain Number 1 Region: 91-137
Classification Level Classification E-value
Superfamily RING/U-box 1.19e-18
Family RING finger domain, C3HC4 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088192   Gene: FBgn0052850   Transcript: FBtr0089123
Sequence length 147
Comment pep:known chromosome:BDGP5:4:335549:342011:1 gene:FBgn0052850 transcript:FBtr0089123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNCLKISTSDDISLLRGNDSQISGTQPVYHQGEHYQRELYPSTSSSTTLTPSSNNRQLS
DENQVKIAKRIGLMQYLPIGTYDGSSKKARECVICMAEFCVNEAVRYLPCMHIYHVNCID
DWLLRSLTCPSCLEPVDAALLTSYEST
Download sequence
Identical sequences Q8SX35
7227.FBpp0088192 NP_726563.1.81976 FBpp0088192 FBpp0088192 FBpp0088192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]