SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088643 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0088643
Domain Number - Region: 143-187
Classification Level Classification E-value
Superfamily RING/U-box 0.000671
Family RING finger domain, C3HC4 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088643   Gene: FBgn0030657   Transcript: FBtr0089702
Sequence length 230
Comment pep:known chromosome:BDGP5:X:15471019:15472017:-1 gene:FBgn0030657 transcript:FBtr0089702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNYHVDSALTTLLENQKFFKEMAEVVSDFSDGREIQKLLDQNVDLAENLIRMKSKHQL
LSKAMKHAKNSSNTIEKFEEVWKERSEAVEQKRIDVKNSAEFKNFMKAAAPQAGAETNGQ
ANSAAHDEDLIMEATGGEVFSLYDPWSKALIKNPVRNKKCGHIYDRDSVMLIITDNIGIR
CPVLGCPNRSYIHPAHLVKDSNLQQKLQERMSDAIEKETSSEEDDEQADH
Download sequence
Identical sequences Q9VXT3
7227.FBpp0088643 FBpp0088643 NP_001285278.1.81976 NP_573043.1.81976 FBpp0088643 FBpp0088643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]