SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088658 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088658
Domain Number 1 Region: 603-704
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.31e-46
Family ets domain 0.00000241
Further Details:      
 
Domain Number 2 Region: 147-250
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.29e-26
Family Pointed domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088658   Gene: FBgn0003118   Transcript: FBtr0089717
Sequence length 718
Comment pep:known chromosome:BDGP5:3R:19116826:19171884:-1 gene:FBgn0003118 transcript:FBtr0089717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELAICKTDLSATKFMLPPALPSSAAIGSSSAVASTASHFLDKAAHELFQLNAINGHLFK
SPASSHLNSVGSPSILSQLNGIGNSGNHSGQVSTMRLKKNRKVTFLSSLVESKNIFIKEE
PIHGCKDLCSLSDISDHEASLEVPTALPPLTPGTNRKVNEVLKASFASWEKEVQKCNITK
DPREWTEEHVIYWLNWAKNEFSLVSMNLDPFYKMKGRAMVDLGKEKFLAITPPFTGDILW
EHLDILQKDCEKPNEDIVHGNSFESATTASVCGSDHQVANYPNETHANSNNSSINSRLSM
DYVTSAGNSDNKNFHRATPHSHNGYNTSNTHDRINNSTPPQQQQSQQPTVNGSGSASSNN
NNSMLPPAVQQSNNENNNTSSSNTNNSSNNNNNSGGSNNSNAGSNNNNNNNNNINFMAAA
AIFQHHLKEEPGTQNGNIGGYGGGSNSQNDPTDLSSYGLPAHLAAYGGGSGSGPTGGRSS
GGGGDESDYHSTISAQDHQSQQSSGGNGSGGASGGSTGNSNGYLDSSSEFYGSYAGRNRF
HDGYPPEFTPYDAQSFQSMGPQPTAMDQWGAAHAHQHPAAYMSTLGLDKGLLGGYTTQGG
VPCFTGSGPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMN
YEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQNLVGHTPEELVAKYDLKIEKKDVD
Download sequence
Identical sequences P51023
FBpp0088658 FBpp0088658 FBpp0088657 7227.FBpp0088658 NP_524461.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]