SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088690 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088690
Domain Number 1 Region: 45-107
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.82e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.000026
Further Details:      
 
Weak hits

Sequence:  FBpp0088690
Domain Number - Region: 302-385
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0349
Family Arfaptin, Rac-binding fragment 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088690   Gene: FBgn0031450   Transcript: FBtr0089749
Sequence length 647
Comment pep:known chromosome:BDGP5:2L:2740995:2743377:1 gene:FBgn0031450 transcript:FBtr0089749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEEELSIEEESLDTMTILKAKGHTFPELREADAMFTADTAPNWADGRVCHRCRVEFTF
TNRKHHCRNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAALQRPTSGSGGAKSGPRP
ADSELPAEYLNSTLAQQVQTPARKTEQELKEEEELQLALALSQSEAEQQKPKLQSLPPAA
YRMQQRSPSPEAPPEPKEYHQQPEEATNPELAKYLNRSYWEQRKISESSSMASPSAPSPM
PPTPQPQQIMPLQVKSADEVQIDEFAANMRTQVEIFVNRMKSNSSRGRSISNDSSVQTLF
MTLTSLHSQQLSYIKEMDDKRMWYEQLQDKLTQIKDSRAALDQLRQEHVEKLRRIAEEQE
RQRQMQMAQKLDIMRKKKQEYLQYQRQLALQRIQEQEREMQLRQEQQKAQYLMGQSAPPF
PYMPPSAVPQHGSPSHQLNNVYNPYAAGVPGYLPQGPAPAPNGHGQFQAIPPGMYNPAIQ
QPMPPNLQPGGLMQQPAPPGNPQMMPPMPENQFANNPAAILQLPQQHSIAQPPQIPFQPQ
PQQIPGQQPQQIPGQQPQQIPGQQPQQIPGQQPQQIPVQQPQPQPQMGHVMLQQHQAPPA
AQAPPVTEIANNQVQAVAAAPAPPQNEPGPAPVKAEEPATAELISFD
Download sequence
Identical sequences C9QP23
FBpp0088690 FBpp0088690 NP_722831.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]