SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088691 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088691
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.03e-39
Family VHS domain 0.000000192
Further Details:      
 
Domain Number 2 Region: 158-220
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.25e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.000026
Further Details:      
 
Weak hits

Sequence:  FBpp0088691
Domain Number - Region: 415-497
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0732
Family Arfaptin, Rac-binding fragment 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088691   Gene: FBgn0031450   Transcript: FBtr0089750
Sequence length 760
Comment pep:known chromosome:BDGP5:2L:2740042:2743377:1 gene:FBgn0031450 transcript:FBtr0089750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRSSFDKNLENATSHLRLEPDWPSILLICDEINQKDVTPKNAFAAIKKKMNSPNPHSSC
YSLLVLESIVKNCGAPVHEEVFTKENCEMFSSFLESTPHENVRQKMLELVQTWAYAFRSS
DKYQAIKDTMTILKAKGHTFPELREADAMFTADTAPNWADGRVCHRCRVEFTFTNRKHHC
RNCGQVFCGQCTAKQCPLPKYGIEKEVRVCDGCFAALQRPTSGSGGAKSGPRPADSELPA
EYLNSTLAQQVQTPARKTEQELKEEEELQLALALSQSEAEQQKPKLQSLPPAAYRMQQRS
PSPEAPPEPKEYHQQPEEATNPELAKYLNRSYWEQRKISESSSMASPSAPSPMPPTPQPQ
QIMPLQVKSADEVQIDEFAANMRTQVEIFVNRMKSNSSRGRSISNDSSVQTLFMTLTSLH
SQQLSYIKEMDDKRMWYEQLQDKLTQIKDSRAALDQLRQEHVEKLRRIAEEQERQRQMQM
AQKLDIMRKKKQEYLQYQRQLALQRIQEQEREMQLRQEQQKAQYLMGQSAPPFPYMPPSA
VPQHGSPSHQLNNVYNPYAAGVPGYLPQGPAPAPNGHGQFQAIPPGMYNPAIQQPMPPNL
QPGGLMQQPAPPGNPQMMPPMPENQFANNPAAILQLPQQHSIAQPPQIPFQPQPQQIPGQ
QPQQIPGQQPQQIPGQQPQQIPGQQPQQIPVQQPQPQPQMGHVMLQQHQAPPAAQAPPVT
EIANNQVQAVAAAPAPPQNEPGPAPVKAEEPATAELISFD
Download sequence
Identical sequences B7FNJ7 Q960X8
FBpp0088690 NP_525099.3.81976 NP_722830.2.81976 FBpp0088691 FBpp0088692 FBpp0088691 FBpp0088692 7227.FBpp0088692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]