SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088699 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088699
Domain Number 1 Region: 739-793
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000099
Family SAM (sterile alpha motif) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088699   Gene: FBgn0050011   Transcript: FBtr0089758
Sequence length 932
Comment pep:known chromosome:BDGP5:2R:6011793:6024977:1 gene:FBgn0050011 transcript:FBtr0089758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSFLSQNSGLLDLQSIFDPQYTHHQQQQQQLLHLSHHPQHHIQQHQNQQLQQQAEQIQ
QHQQERTLSTKFDLNLFNELDQMEFNNLNRSQYQNNNNNNSISNNQNSNNNTNTTNGISE
NLNQIQNRHFISGYHHQHIGSDYEQVINFVDSPPNSEESWTESSSLIEQITIVVDGQSKD
SPGPQIIDVQTIYLNSGSRKRRMDWDSLDIGQSENSPTASQSGDLPSKVAHQEKEKHKRE
KHSGRSSWSDDIGFDLNAEFNSNSYLNNENFLSFSPTLTTLKQEPQTDQIKPSPKVSLDN
ASASPSIAIAKLDEVQNSPSQAISGQDSANGSGSAANGKHDVNSGLACGCGSPQGSPLAN
AEYELNEKGKPQQLSVLDPAKIEIGSANGATHAEDHKFQYILAAATSIATKNNEETLTYL
NQGQSYEIKLKKIGDLSLYRDKILKSVIKICFHERRLQFMEREQMQQWQQSRPGERIIEV
DVPLSYGLCHVSQPLSSGSLNTVEIFWDPLKEVGVYIKVNCISTEFTPKKHGGEKGVPFR
LQIETYIENTNSATASGSGGSNNSAIASGSGSSGSAAPASPERTPSAGSNGKQAVHAAAC
QIKVFKLKGADRKHKQDREKIQKRPQSEQEKFQPSYECTIMNDISLDLVMSATTTGCYSP
EYMKLWPNSPVHIPKYDGMLPFAPSAASPATSSSPIAINSVTSTNSPTLKLMDATNMVSP
QHVPADMDDYSQNIMPESTPSQVTQWLTNHRLTAYLSTFAQFSGADIMRMSKEDLIQICG
LADGIRMFNILRAKTIAPRLTLYASVDGCSYNAIYLLSNTAKELQQKLFKMPGFYEFMAK
ASAQENGAGGAATAAAAALFNNWGMHSKYSGSGSNIFNDANKSCVYISGPSGILVTITDE
VLNNEIKDGSLYALEVQAGKVILKLINKQDNN
Download sequence
Identical sequences A1Z851
7227.FBpp0088699 NP_610556.1.81976 FBpp0088699 FBpp0088699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]