SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088700 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088700
Domain Number 1 Region: 726-780
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000974
Family SAM (sterile alpha motif) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088700   Gene: FBgn0050011   Transcript: FBtr0089759
Sequence length 919
Comment pep:known chromosome:BDGP5:2R:6011793:6024977:1 gene:FBgn0050011 transcript:FBtr0089759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSFLSQNSGLLDLQSIFDPQYTHHQQQQQQLLHLSHHPQHHIQQHQNQQLQQQAEQIQ
QHQQERTLSTKFDLNLFNELDQMEFNNLNRSQYQNNNNNNSISNNQNSNNNTNTTNGISE
NLNQIQNRHFISGYHHQHIGSDYEQVINFVDSPPNSEESWTDGQSKDSPGPQIIDVQTIY
LNSGSRKRRMDWDSLDIGQSENSPTASQSGDLPSKVAHQEKEKHKREKHSGRSSWSDDIG
FDLNAEFNSNSYLNNENFLSFSPTLTTLKQEPQTDQIKPSPKVSLDNASASPSIAIAKLD
EVQNSPSQAISGQDSANGSGSAANGKHDVNSGLACGCGSPQGSPLANAEYELNEKGKPQQ
LSVLDPAKIEIGSANGATHAEDHKFQYILAAATSIATKNNEETLTYLNQGQSYEIKLKKI
GDLSLYRDKILKSVIKICFHERRLQFMEREQMQQWQQSRPGERIIEVDVPLSYGLCHVSQ
PLSSGSLNTVEIFWDPLKEVGVYIKVNCISTEFTPKKHGGEKGVPFRLQIETYIENTNSA
TASGSGGSNNSAIASGSGSSGSAAPASPERTPSAGSNGKQAVHAAACQIKVFKLKGADRK
HKQDREKIQKRPQSEQEKFQPSYECTIMNDISLDLVMSATTTGCYSPEYMKLWPNSPVHI
PKYDGMLPFAPSAASPATSSSPIAINSVTSTNSPTLKLMDATNMVSPQHVPADMDDYSQN
IMPESTPSQVTQWLTNHRLTAYLSTFAQFSGADIMRMSKEDLIQICGLADGIRMFNILRA
KTIAPRLTLYASVDGCSYNAIYLLSNTAKELQQKLFKMPGFYEFMAKASAQENGAGGAAT
AAAAALFNNWGMHSKYSGSGSNIFNDANKSCVYISGPSGILVTITDEVLNNEIKDGSLYA
LEVQAGKVILKLINKQDNN
Download sequence
Identical sequences Q8SY59
FBpp0088700 NP_724893.3.81976 NP_724895.1.81976 FBpp0088700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]