SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089023 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089023
Domain Number 1 Region: 283-341
Classification Level Classification E-value
Superfamily RING/U-box 2.3e-20
Family RING finger domain, C3HC4 0.000044
Further Details:      
 
Domain Number 2 Region: 128-212
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000151
Family RING finger domain, C3HC4 0.049
Further Details:      
 
Domain Number 3 Region: 204-271
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000303
Family IBR domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089023   Gene: FBgn0017418   Transcript: FBtr0089508
Sequence length 503
Comment pep:known chromosome:BDGP5:X:18026185:18031718:-1 gene:FBgn0017418 transcript:FBtr0089508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDNDNDFCDNVDSGNVSSGDDGDDDFGMEVDLPSSADRQMDQDDYQYKVLTTDEIVQH
QREIIDEANLLLKLPTPTTRILLNHFKWDKEKLLEKYFDDNTDEFFKCAHVINPFNATEA
IKQKTSRSQCEECEICFSQLPPDSMAGLECGHRFCMPCWHEYLSTKIVAEGLGQTISCAA
HGCDILVDDVTVANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPR
RVHCKCGHVFCFACGENWHDPVKCRWLKKWIKKCDDDSETSNWIAANTKECPRCSVTIEK
DGGCNHMVCKNQNCKNEFCWVCLGSWEPHGSSWYNCNRYDEDEAKTARDAQEKLRSSLAR
YLHYYNRYMNHMQSMKFENKLYASVKQKMEEMQQHNMSWIEVQFLKKAVDILCQCRQTLM
YTYVFAYYLKKNNQSMIFEDNQKDLESATEMLSEYLERDITSENLADIKQKVQDKYRYCE
KRCSVLLKHVHEGYDKEWWEYTE
Download sequence
Identical sequences A4V4Q7 Q94981
FBpp0088499 7227.FBpp0089023 FBpp0088499 FBpp0088500 FBpp0089023 FBpp0297199 FBpp0305073 FBpp0305074 NP_001245736.1.81976 NP_001259671.1.81976 NP_001259672.1.81976 NP_523399.1.81976 NP_728145.1.81976 NP_996500.1.81976 FBpp0088499 FBpp0088500 FBpp0089023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]