SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089103 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089103
Domain Number 1 Region: 3-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.27e-81
Family G proteins 0.0000000138
Further Details:      
 
Domain Number 2 Region: 338-441
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.51e-42
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000052
Further Details:      
 
Domain Number 3 Region: 238-334
Classification Level Classification E-value
Superfamily Translation proteins 1.57e-28
Family Elongation factors 0.000009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089103   Gene: FBgn0000557   Transcript: FBtr0085834
Sequence length 462
Comment pep:known chromosome:BDGP5:3R:27565382:27569028:1 gene:FBgn0000557 transcript:FBtr0085834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKK
IGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDAILPPQR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVNFAPVNLVTEVKSVEMHHEALT
EAMPGDNVGFNVKNVSVKELRRGYVAGDSKNNPPRGAADFTAQVIVLNHPGQIANGYTPV
LDCHTAHIACKFSEIKEKCDRRTGKTTETEPKAIKSGDAAIIVLVPSKPLCVESFQEFPP
LGRFAVRDMRQTVAVGVIKSVNFKETTSGKVTKAAEKAQKKK
Download sequence
Identical sequences A4V3Q6 B3P515 B4IJ22 B4PP14 B4QT88 P05303
FBpp0085193 FBpp0085194 FBpp0089103 FBpp0089104 NP_524611.1.81976 NP_733449.1.81976 NP_996315.1.81976 NP_996316.1.81976 XP_001981059.1.56816 XP_002043732.1.34323 XP_002099538.1.41174 XP_015009128.1.56816 XP_015049178.1.41174 XP_016037139.1.80810 XP_016037140.1.80810 XP_016037141.1.80810 XP_016037142.1.80810 7227.FBpp0085194 7245.FBpp0255969 FBpp0197923 FBpp0255969 FBpp0085193 FBpp0085193 FBpp0085194 FBpp0089103 FBpp0089104 FBpp0220000 FBpp0130372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]