SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089211 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089211
Domain Number 1 Region: 13-295
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.98e-64
Family BAR domain 0.0029
Further Details:      
 
Domain Number 2 Region: 401-582
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00000503
Further Details:      
 
Domain Number 3 Region: 956-1013
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000249
Family SH3-domain 0.00027
Further Details:      
 
Domain Number 4 Region: 272-376
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000196
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089211   Gene: FBgn0030685   Transcript: FBtr0074196
Sequence length 1016
Comment pep:known chromosome:BDGP5:X:15645707:15654741:-1 gene:FBgn0030685 transcript:FBtr0074196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGGKNVRRGLEPLEFEECIVDSPDFRENLNRHEKELDHTSHQIKRIIKEVKDLMSAAKI
LSTRMKQLAILLNDFNFECIGTAQTDDENVICESLKRFGAIIGNIEDEREKMLTLADKHI
IESLEDFRKKQIGGVKENKKKFDKKTEKFCQSQERFLNMSTKKPENTIQEADASLGMHER
EYIQESLSYVLRIQEVQERIKFEFVEILLAFISGWLVFYHTAHEQAEDHRDYLQDLRHKV
QKTRENFEEAREKVTELKTKYMEKRTKPEEIFTKRGYLFLMEKKPFKATWTKYYCTFKKQ
KREFTMLQFNQMNHNFTRPEARDDEKLTLFSCQRRASEFEKRFCFDLTFKEKPGVVYTFQ
ALSEKDHRYWISAMDGTEPTYLAPGKIKVSEAYHLDEAGFMFIRRCIQVLEIRGLEDEGI
YRKSGVGTKISKLLALGLNQKESDDVFVDDKYRDLMESNTIASALKMYLRNLNEPLMTYQ
YHSDFIEAAKQETLNQRVNEVHKLVYKLPQPNFQMLDMVICHLTDVSRKYEKNKMSVFNL
GVVFGPTLLRPREESVAAILDIKFNNIVINILIDNYERIFKNKPSADIKLPDATKAPSIM
YPSRSSPPTRMPRASQIGKAASTGAMGSSSNTAGNPMFLNQQKIYRVVSKTNCTEPTMSS
SLQNIPNGDNYALGSNAMNSSGGAQCISLSPPMHMLNGILSPTIGSINNLHTISKNETST
RRYVPDTEIAPDYGIIGANNGGVTLQSHHAVPVSSTSNFRHPEYLMTTANPVTQSGSSSH
IYTNTSSAGANSSNRISLSNVSPPNTAMRKERFLGSASGPQQHPPVQRGLHSYGQTKHYS
PLMPTSTSSSNDSVCDSLSSNNGLGSSIVANSGNSGNVAQHLSARNTNDYALISSQNSSL
SPHLGPTCDEVVTATTLPSVSLSCGGTASESTEYPPSKMHRNRDVNQIKRDLSTGTARVR
TLYACMGESEGELSFEPNQIITNVRYSHEPGWLQGTLNGKTGLIPENYVEHLKPHH
Download sequence
Identical sequences Q9VXQ2
7227.FBpp0089212 FBpp0073979 FBpp0089209 FBpp0089210 FBpp0089211 FBpp0089212 FBpp0089213 NP_573070.2.81976 NP_996442.1.81976 NP_996443.1.81976 NP_996445.1.81976 FBpp0073979 FBpp0089209 FBpp0089210 FBpp0089211 FBpp0089212 FBpp0089213 FBpp0073979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]