SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089216 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089216
Domain Number 1 Region: 771-1349
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 6e-203
Family Myeloperoxidase-like 0.000000000504
Further Details:      
 
Domain Number 2 Region: 37-240
Classification Level Classification E-value
Superfamily L domain-like 7.18e-37
Family Ngr ectodomain-like 0.0073
Further Details:      
 
Domain Number 3 Region: 235-327
Classification Level Classification E-value
Superfamily Immunoglobulin 4.02e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 455-551
Classification Level Classification E-value
Superfamily Immunoglobulin 1.79e-18
Family I set domains 0.0077
Further Details:      
 
Domain Number 5 Region: 552-645
Classification Level Classification E-value
Superfamily Immunoglobulin 9.06e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 364-462
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-16
Family I set domains 0.022
Further Details:      
 
Domain Number 7 Region: 1463-1524
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000324
Family VWC domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089216   Gene: FBgn0011828   Transcript: FBtr0072954
Sequence length 1527
Comment pep:known chromosome:BDGP5:3L:2601455:2630072:-1 gene:FBgn0011828 transcript:FBtr0072954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFMLLMLQLLGLLLLLAGGVQSVYCPAGCTCLERTVRCIRAKLSAVPKLPQDTQTLDLR
FNHIEELPANAFSGLAQLTTLFLNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIF
QRMPRLEAIFLENNDIWQLPAGLFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLD
GNAIDCNCGVYSLWRRWHLDVQRQLVSISLTCAAPQMLQNQGFSSLGEHHFKCAKPQFLV
APQDAQVAAGEQVELSCEVTGLPRPQITWMHNTQELGLEEQAQAEILPSGSLLIRSADTS
DMGIYQCIARNEMGALRSQPVRLVVNGGNHPLDSPIDARSNQVWADAGTPMHGATPLPSP
LPSPPHFTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQWFVNGRQLLQSTPSLQLQANG
SLILLQPNQLSAGTYRCEARNSLGSVQATARIELKELPEILTAPQSQTIKLGKAFVLECD
ADGNPLPTIDWQLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSV
EATIKVERSQSPPQLAIEPSNLVAITGTTIELPCQADQPEDGLQISWRHDGRLIDPNVQL
AEKYQISGAGSLFVKNVTIPDGGRYECQLKNQFGRASASALVTIRNNVDLAPGDRYVRIA
FAEAAKEIDLAINNTLDMLFSNRSDKAPPNYGELLRVFRFPTGEARQLARAAEIYERTLV
NIRKHVQEGDNLTMKSEEYEFRDLLSREHLHLVAELSGCMEHREMPNCTDMCFHSRYRSI
DGTCNNLQHPTWGASLTAFRRLAPPIYENGFSMPVGWTKGMLYSGHAKPSARLVSTSLVA
TKEITPDARITHMVMQWGQFLDHDLDHAIPSVSSESWDGIDCKKSCEMAPPCYPIEVPPN
DPRVRNRRCIDVVRSSAICGSGMTSLFFDSVQHREQINQLTSYIDASQVYGYSTAFAQEL
RNLTSQEGLLRVGVHFPRQKDMLPFAAPQDGMDCRRNLDENTMSCFVSGDIRVNEQVGLL
AMHTIWMREHNRIASKLKQINSHWDGDTLYQEARKIVGAQMQHITFKQWLPLIIGESGME
MMGEYQGYNPQLNPSIANEFATAALRFGHTIINPILHRLNETFQPIPQGHLLLHKAFFAP
WRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQTAHAVALDLAAINIQRGRDH
GMPGYNVYRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEG
GKVGPLFQCLLVEQFRRLRDGDRLYYENPGVFSPEQLTQIKQANFGRVLCDVGDNFDQVT
ENVFILAKHQGGYKKCEDIIGINLYLWQECGRCNSPPAIFDSYIPQTYTKRSNRQKRDLG
KENDEVATAESYDSPLESLYDVNEERVSGLEELIGSFQKELKKLHKKLRKLEDSCNSADS
EPVAQVVQLAAAPPQLVSKPKRSHCVDDKGTTRLNNEVWSPDVCTKCNCFHGQVNCLRER
CGEVSCPPGVDPLTPPEACCPHCPMVK
Download sequence
Identical sequences D2NUH5 Q9VZZ4
7227.FBpp0089216 FBpp0072828 FBpp0089205 FBpp0089215 FBpp0089216 FBpp0072828 FBpp0089205 FBpp0089215 FBpp0089216 NP_523891.2.81976 NP_995975.1.81976 NP_995976.1.81976 NP_995977.1.81976 FBpp0072827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]