SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089239 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089239
Domain Number 1 Region: 763-1030
Classification Level Classification E-value
Superfamily NHL repeat 6.41e-35
Family NHL repeat 0.0000000000742
Further Details:      
 
Domain Number 2 Region: 322-361
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000229
Family B-box zinc-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089239   Gene: FBgn0010300   Transcript: FBtr0081160
Sequence length 1037
Comment pep:known chromosome:BDGP5:2L:19158540:19179758:1 gene:FBgn0010300 transcript:FBtr0081160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSPTPSLDSMRGGANSIESYEHAGYLSDSPLTLSGSSPPASDSAICSDEYTGGSSVKS
RSEVTVINGHHPISASVSSSSSASSSSCSSSSSSSSSSSSSSSSTSGLSGCGSTSSSVIS
ANNVASSNGPGVIGSNLQSSNNGGNSGISSLVVGAGKGSNSSSNSSSSNTSANGSPPRCT
ACKSKCSDAVAKCFECQSYLCANCVTAHEFMHCFNGHNVCLIKGFEASTTGTPLSVGSPS
NNPASNEFKYASSLTMMLQQQQQLDSQQQQQQQQLLPAQPMSQLSKIVLAAAAQANSQEQ
QREDSIYGSLHPQQQQQQQQQQQRQLFCPRHKQELLKFSCRTCCILVCKECIVLEHSTGL
HELENVQSPGMTTSTGSTANESALQTLLADMRGKIGEIVGIAGNSDQNLTKVKLQYQKAH
NELNETHQFFASMLDERKTELLKELETLYTAKVNSNNSWQQRSRDLIDKGLATCEAVERS
PAPPSSLLTEALLLRKSLEQQLQTGIQEMQLPFEIEFMSNYQSIQAGVRNTFGYIRANSS
DGGPTGMSLTSNGHGKQPPIARPTQSASNSSASSAGSGHHGHHQQSHHHGHHNHHQTAHH
QQLQAQSSLHGLGLGLSGASLLDSSSSAGGAVGAFSNGGLLLGGRDRNALAVEQHFGELM
PKRGGGGYTGSNGSATSAVAHYNPYEKWSNGGSDNLFSSVTSGVSGSSAVADAFASLSAV
GGSVVSGAGAGGSTVSSESLLDLTNKLLSATIYPPKSQIKRQKMIYHCKFGEFGVMEGQF
TEPSGVAVNAQNDIIVADTNNHRIQIFDKEGRFKFQFGECGKRDSQLLYPNRVAVVRNSG
DIIVTERSPTHQIQIYNQYGQFVRKFGATILQHPRGVTVDNKGRIIVVECKVMRVIIFDQ
NGNVLHKFGCSKHLEFPNGVVVNDKQEIFISDNRAHCVKVFNYEGQYLRQIGGEGITNYP
IGVGINSNGEILIADNHNNFNLTIFTQDGQLISALESKVKHAQCFDVALMDDGSVVLASK
DYRLYIYRYVQLAPVGM
Download sequence
Identical sequences E8NHB3 Q8MQJ9
7227.FBpp0080702 NP_001286083.1.81976 NP_476945.1.81976 NP_599129.1.81976 NP_995726.1.81976 FBpp0080702 FBpp0080703 FBpp0089239 FBpp0080702 FBpp0080703 FBpp0089239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]