SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089256 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089256
Domain Number 1 Region: 423-734
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-81
Family Protein kinases, catalytic subunit 0.0000315
Further Details:      
 
Weak hits

Sequence:  FBpp0089256
Domain Number - Region: 1072-1133
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000263
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 
Domain Number - Region: 96-177,213-250
Classification Level Classification E-value
Superfamily TPR-like 0.00721
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089256   Gene: FBgn0014006   Transcript: FBtr0083819
Sequence length 1196
Comment pep:known chromosome:BDGP5:3R:15705441:15711758:1 gene:FBgn0014006 transcript:FBtr0083819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREKFLSDMRTARDTYATNGAKLQSILHEMRKRLDDPHVLSGEVVHSFMCSLRDVQDYDA
MVRLVNDLKNIPNTRKYVETGNMSFLYAFALNRRNRKGDREKALESSLKALEKKENHFPD
MLCLCGRIYKDIFVESDYTDATSLAHAIKWYRQSFEVQPNEYAGINLATLLVIEGKEFTN
TEELQHIGMTLNNLIGKKGSLSSLSEYWDVATFFEISVLANDYAKAIQAAECMFKLKPPN
WYLKSTIGNISLIHRFRKKPEERQPPIEEQVFQFWMDFFLEATNTEEVKNSIRFPILILE
PQKIYMPSYVTINMDADEKSIQIVNICLAHAKNACKKIHDFLFVASKIKSVSLYKRDDRC
AYLYVHHNSDDFQIYFPSTERRQKFYDMILEMTADQVVFVNLSNDDANIEYEYDYDEQNR
KMVLGKGTYGTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLHSQLRHRNIVRYLG
SCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHR
DIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETFTGTLQYMAPEVIDQGVRGYGPAA
DIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAIS
VMDRPSASQLLEDPFLQDKPRKVRPALPINTEFGRSISVPADRFVHKTTPPLSYNTTCNT
PTTPELDITHSSSVDIDELPSNQFMLERRNSHGFLLSPEIEPSTPSLRTSISETSETDGF
YRLKKDSQRRTTLSKVLALDESKICDIWLKKVDADQNSIAIRKSDLEVLIRGLRDYIMNE
NEKHLEATINELKQKLNNDAVALDHLHLALYSFQDAVVCVLRYHCIKPHWMFALDNLVKR
AVQAAVTIFSPELGANLADKDLSGNDDESLRTSLMQKGSTESQEKQSLEKVLPTSNTREG
VGLTPAESGGDALSSSMECARILRDIRDNQQKLQRQLLEQQRQSMRALHNISQELAHIYM
GGRKRLRRTINGFNKKCHRMSTSVGGTSGVRPNIAGNPRRQLNKHHFGLHEVDEQLEQWL
TQQEIDEFSKTLILNEGFTFDDFIYNMEKLDLMRLGLRVGIEVRLWKLIIQERVCTSSDC
VDSPPSTYHKPIGGNSSFALIDNNNTLPSPTTTTPGTPGIKTKIKKSESEYDSCSE
Download sequence
Identical sequences Q7KSB7
FBpp0089256 NP_996240.1.81976 FBpp0089256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]