SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089327 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089327
Domain Number 1 Region: 915-1120
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-44
Family Fibronectin type III 0.00018
Further Details:      
 
Domain Number 2 Region: 1120-1317
Classification Level Classification E-value
Superfamily Fibronectin type III 6.57e-37
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 3 Region: 1409-1586
Classification Level Classification E-value
Superfamily Fibronectin type III 6.83e-30
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 4 Region: 817-921
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 429-530
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 1328-1411
Classification Level Classification E-value
Superfamily Immunoglobulin 3.88e-20
Family I set domains 0.039
Further Details:      
 
Domain Number 7 Region: 337-422
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 8 Region: 717-821
Classification Level Classification E-value
Superfamily Immunoglobulin 2.45e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 9 Region: 531-621
Classification Level Classification E-value
Superfamily Immunoglobulin 2.57e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 10 Region: 263-343
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000619
Family I set domains 0.033
Further Details:      
 
Domain Number 11 Region: 615-721
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000102
Family I set domains 0.033
Further Details:      
 
Domain Number 12 Region: 38-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000553
Family I set domains 0.016
Further Details:      
 
Domain Number 13 Region: 147-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000483
Family V set domains (antibody variable domain-like) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089327   Gene: FBgn0033159   Transcript: FBtr0089020
Sequence length 2022
Comment pep:known chromosome:BDGP5:2R:3207059:3269374:-1 gene:FBgn0033159 transcript:FBtr0089020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIE
CKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLAR
NQFGSIISRDVHVRAVVAQYYDTDVNKAYVIRGNAAVLKCEIPSFVADFVSVVSWHTDQN
EDFLPGSEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE
PVGFKAPSFPSVASTFTIQSPKKSELALTCEAQSYPVPIFKWYKFIEGTTRKQAVVLNDR
VKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRP
AVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAE
LKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQ
YVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVA
GETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAK
NQEGYSARGSLEVQVMVPPQVVPFDFGEETINMNDMVSATCTVNKGDTPLELYWTTAPDP
TTGVGRLMSNDGILITKTTQRISMLSIESVHARHRANYTCVARNAAGVIYHTAELRVNVP
PRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGT
LHVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCE
AKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATN
AFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRAS
WSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQ
NIKVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHN
LELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVG
WVSPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLAT
TAGGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKA
EGAETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAK
IASFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNR
QDAGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHG
YTLHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKG
QKPKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNN
YVVLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPSRDLPELSAEDTIRIIL
SNLNLVVPVVAALLVIIIAIIVICILRSKGNHHKDDVVYNQTMGPGATLDKRRPDLRDEL
GYIAPPNRKLPPVPGSNYNTCDRIKRGRGGLRSNHSTWDPRRNPNLYEELKAPPVPMHGN
HYGHAHGNAECHYRHPGMEDEICPYATFHLLGFREEMDPTKAMNFQTFPHQNGHAGPVPG
HAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTPAPEYDDPANCAEEDQY
RRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPYDHYGSRGSMGRRSI
GSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDRDHGPRGNYGAVKRSPQ
PKDQRTTEEMRKLIERNETGPKQLQLQQANGAGFTAYDTMAV
Download sequence
Identical sequences A1Z6X2
NP_995769.1.81976 FBpp0089327 FBpp0089327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]