SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089379 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089379
Domain Number 1 Region: 602-663
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000243
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089379   Gene: FBgn0039668   Transcript: FBtr0085432
Sequence length 809
Comment pep:known chromosome:BDGP5:3R:25324747:25329271:-1 gene:FBgn0039668 transcript:FBtr0085432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRTKVLGLVDVMMRVPPVMVIDEILKMDMGMQSWLYPDKDKASGALATPTEAPAVPSG
QDPFTSIKELFSHMTTSAQSVLEQSIEKASEAAKTHGMLSSGFNSLMNELSKDQTLADVL
STTTVKFVLCVFAFLSAACIFMLWTRHLVMVYMFLTSLGLTFLSYWSNVSALALTERSPS
MVEDLMSLNTTRLLDSGGVVMSLAPHLMAQWFMGMLFAYIHLGPRFEHVQRSMPIIFASP
ILLAMLPLPAKVVQHLPVVAVFTPIILTKITLMQSAMEASRTVYNGYQYAMNFVSNFGLS
ALIENEWQRLNVPNVLRVFWTIRLIQGGYALATTESDEPLDLMTATQKLLVDGCETMTAV
LGMTGVISMFCHYIGRGFQWYLLTYDDEEKSLGTVSAVLFYILALQTGLTSLSPDKRFIR
LCRNLCLLMTALLHFLHNIVSPILMSLSAARNPSRKRHVRALSVCAFLVVLSVSLLYHLW
SQQSISTWLLAVTAFSVEVVVKVLVSLATYTLFLLDARRQFFWEKLDDYLYYVRAFGNSV
EFCFGILLFINGAWILIFESAQNATGGGIRAIMMCIHAYFNIWCEARAGWSVFMKRRSAV
HKISALPEATPAQLQAFDDVCAICYQEMYSAKITRCRHFFHGVCLRKWLYVQDRCPLCHE
IMMYTDKADENAPEAEPAPAAQAEQPMRIYPRDDANNAAAQRRSPERAPVEASEQAPATS
SSSAAATIGAEAVSAIVESAAAVGEARSLVSVASSSSATHRISASGSSDSSYMTASAQSP
PPTATSAAAVATAAASNTTHMFRMSQDQQ
Download sequence
Identical sequences Q7KRW1
7227.FBpp0089379 FBpp0089379 NP_996303.1.81976 FBpp0089379 FBpp0084797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]