SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0089414 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0089414
Domain Number 1 Region: 74-271,311-325
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 8.65e-44
Family AlkB-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0089414   Gene: FBgn0065035   Transcript: FBtr0074168
Sequence length 332
Comment pep:known chromosome:BDGP5:X:15752167:15753520:-1 gene:FBgn0065035 transcript:FBtr0074168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKLVFKQYKCKSTSPDLTEVVKIDDCVVKGNDQEKSDNNIVQRLSISNVESLQTMPGVK
SPKDWRTYTLTNHPGIIVIRNPFSERGRRYWSARCLRDFPRTPNIVNLNERLFDESVRSD
WWKQLNLCSDGVEFQRIKSAMRWTTFGYHHNWDTKIYDEEMQSPFPEDLSSLCGLFAQAL
GYADFKPEAAIVNYYPVGSTLSGHTDHSEPNKSAPLFSFSFGQTAIFLIGGRSLEEKPTA
IYLQSGDVMIMSGESRLCYHAVPRIIKTQASATLSLIIEDVDNADIKTRTIDKDLFHDVG
NPQFWEPFSRYMDDSRININIRQVLNPGDVKL
Download sequence
Identical sequences Q7KUZ2
FBpp0089414 FBpp0089414 NP_001334682.1.81976 NP_996458.1.81976 7227.FBpp0089414 FR306 FBpp0089414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]