SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0091098 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0091098
Domain Number 1 Region: 43-130
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.14e-22
Family Linker histone H1/H5 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0091098   Gene: FBgn0053852   Transcript: FBtr0091856
Sequence length 256
Comment pep:known chromosome:BDGP5:2L:21516898:21517795:1 gene:FBgn0053852 transcript:FBtr0091856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNL
KERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSAS
AKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAEN
KKTEKAKAKDAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASV
SATAKKPKAKTTAAKK
Download sequence
Identical sequences A0A0J7K878 P02255
FBpp0085248 FBpp0091052 FBpp0091057 FBpp0091059 FBpp0091062 FBpp0091065 FBpp0091068 FBpp0091071 FBpp0091074 FBpp0091077 FBpp0091083 FBpp0091086 FBpp0091089 FBpp0091092 FBpp0091095 FBpp0091098 FBpp0091110 NP_001027286.1.81976 NP_001027295.1.81976 NP_001027299.1.81976 NP_001027304.1.81976 NP_001027309.1.81976 NP_001027314.1.81976 NP_001027319.1.81976 NP_001027324.1.81976 NP_001027329.1.81976 NP_001027339.1.81976 NP_001027344.1.81976 NP_001027349.1.81976 NP_001027354.1.81976 NP_001027359.1.81976 NP_001027364.1.81976 NP_001027384.1.81976 NP_724341.1.81976 XP_015438106.1.55303 FBpp0085248 FBpp0091052 FBpp0091057 FBpp0091059 FBpp0091062 FBpp0091065 FBpp0091068 FBpp0091071 FBpp0091074 FBpp0091077 FBpp0091083 FBpp0091086 FBpp0091089 FBpp0091092 FBpp0091095 FBpp0091098 FBpp0091110 7227.FBpp0085248 7227.FBpp0091052 7227.FBpp0091057 7227.FBpp0091059 7227.FBpp0091062 7227.FBpp0091065 7227.FBpp0091068 7227.FBpp0091071 7227.FBpp0091074 7227.FBpp0091077 7227.FBpp0091083 7227.FBpp0091086 7227.FBpp0091089 7227.FBpp0091092 7227.FBpp0091095 7227.FBpp0091098 7227.FBpp0091110 FBpp0085248 FBpp0091052 FBpp0091057 FBpp0091059 FBpp0091062 FBpp0091065 FBpp0091068 FBpp0091071 FBpp0091074 FBpp0091077 FBpp0091083 FBpp0091086 FBpp0091089 FBpp0091092 FBpp0091095 FBpp0091098 FBpp0091110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]