SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099488 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099488
Domain Number 1 Region: 32-271,308-334
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.57e-61
Family BAR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 546-704
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.14e-51
Family Ankyrin repeat 0.0000427
Further Details:      
 
Domain Number 3 Region: 427-542
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.98e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0000562
Further Details:      
 
Domain Number 4 Region: 309-413
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-18
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 5 Region: 1093-1154
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-16
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099488   Gene: FBgn0050372   Transcript: FBtr0100140
Sequence length 1155
Comment pep:known chromosome:BDGP5:2R:4002645:4010357:-1 gene:FBgn0050372 transcript:FBtr0100140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPSLIAVSEFVEETRSDYSSPTTSTFASRMPDCRHTIGVLEERLEFDREGLTKLKKAVK
AIHNSGNTHVDNEMFMVRALERLGGKVIEQDEPDIGAAFLKFSVVTKELSALMKTLMQNI
NNIVMFPVDSMLKSELRGVKGDMKRPFDKAAKDYEAKFIKIEKEKKAQAKEAGMVRTEID
AAVVAEEMEKERRLYQLQTCEYLLKYKDIKTKTGIELLQHLIEYYHALSNYFKDGLQTIE
HFGTYIGDLSEKLHEIKQKQDEDRRSLLDLRTVLRSTPDFERVDNVPSSESRSGGAGYSL
HQLQGDKHHGVTRQGHLLKKSEGKVRRVWQKRRCRVTSDGFLDIFHADESKPPTRVNLLT
CQIKPVPDDKRGFDLISYNRPYHFQAEDEGDQKAWMAVLVNCKEKALTKAFQHANPQMSP
SLVELQKTVIRYVQLLPGNDRCCDCGSRNDVTWISLNFGILVCIQCSGVHRDLGVHHSRI
QSLTLDNLTTANLLIARAMGNSTLNDIMEAKLGRGKLQHESSMEERYDFIRAKYVAKRYV
MRTCSDDNDLRCDLEQAVVNADMSQLLQVWAEGADLTCCLPSSDAGETALHLAVLREMGS
TLHIVDFLIQNMPPKGLNKATNPAGLLDVTGKNTALHLCALHDRRECMKLLLRSGADYEL
KNSQNKTALDIAKEMGHNSCRELIECAIKREKSAFDHINTDWNLPNEDGSTDFSDDETVI
DERKSRSRPPSFAGGDSPVLRSRSSTCDSIQSSSSPIANCPSRQFTLPSGLPSYTHSAGT
SPKQHISVGQYLGSATNVGGNGPGNGGSSPSSASSQSVRAARNSLNMQSDLGGHVTGARK
STSTANMNSLKKRTAPAPPPGTLGSASSSSFYGTLPHPPRHSQNFDASDIRAINHKNQSL
DVAYGTLPHLRSVESSPRGGGGYGYGVSQDPGGSGNGSNNSLMPAMTTFGHKRSPSGESL
NRNIHLAGAKLVLPPTGELPTLKHVDKSALTRPKIPPPGPPSEREISNGQSNESISSMDE
GPVAPPRKLVNQSANFPDYESWHTDMDSSGGGLDHSAESNVSSSDNDRLNSSPDNPSKTG
GAGLGGKFHYNGQRRCRALYDCVADNDDELEFKEGEILIVLNERTDDENWMEGIIEGQPT
RKGMFPVSFVHMLPD
Download sequence
Identical sequences A1Z7A6
FBpp0099488 7227.FBpp0099488 NP_001014504.1.81976 FBpp0099488 FBpp0099488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]