SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099683 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099683
Domain Number 1 Region: 111-182
Classification Level Classification E-value
Superfamily RING/U-box 8.24e-21
Family ZZ domain 0.0091
Further Details:      
 
Domain Number 2 Region: 547-596
Classification Level Classification E-value
Superfamily UBA-like 8.16e-16
Family UBA domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099683   Gene: FBgn0003231   Transcript: FBtr0100289
Sequence length 599
Comment pep:known chromosome:BDGP5:2L:19542640:19545548:1 gene:FBgn0003231 transcript:FBtr0100289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEKLLKITYQGAGPQKKINAYLRMPSQNYTILRREIELYLFQERQLPKCDVRTFWIDAD
KDEIEIVNQNDYEIFLAKCESNMHVQVAPLAPVEEPKATKQEGSSANAEAPSVDDPSNFT
IHDAVECDGCGLAPLIGFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPTNNGPGMVDAW
FTGPGLGRRSGRRSRGHCPFQETNQADPAGEPARDSRRERRQARRHAGVLTQFVEMMTNL
PLNTTTATAPAEPQKPKAAEQTESPPQAEPTVTAEKAAESEAKPTEPKKVNTDQSVPRTE
DPVTTPRSTQPTTPVINLDNISQIVPPEYMSAGIEILNNFSEMFSKIIDTTEGGDSGIFA
PSTTPSAENKKPEEQGQSSGQSGASSANQSAVPSAAPSANQSNVPSANQSATPSISGSIP
DAQLETEPLNPKPSETTTETEQERRRSDSLDPEWQLIDNAYSANNSNLINLDTTNPTAAP
QEPVRDFGQLGELLRQHMNEEARVEQASANTQTAQVDTVSTSTSTTSVTTNSVGTSPAAP
DDKRTVPVYHTDESINKSIHAMMAMGFSNEGAWLTQLLESVQGNISAALDVMNVSQNRN
Download sequence
Identical sequences P14199
FBpp0080794 FBpp0099683 7227.FBpp0080794 NP_001014491.1.81976 NP_476700.1.81976 FBpp0080794 FBpp0099683 FBpp0080794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]