SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099776 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099776
Domain Number 1 Region: 9-65
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000105
Family ZZ domain 0.014
Further Details:      
 
Domain Number 2 Region: 474-554
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000115
Family SWIRM domain 0.01
Further Details:      
 
Domain Number 3 Region: 66-120
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000122
Family Homeodomain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099776   Gene: FBgn0037555   Transcript: FBtr0100368
Sequence length 555
Comment pep:known chromosome:BDGP5:3R:4062840:4066230:-1 gene:FBgn0037555 transcript:FBtr0100368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTIADLFTKYNCTNCQDDIQGIRVHCAECENFDLCLQCFAAGAEIGAHQNNHSYQFMDT
GTSILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKHIETKSAEDAKEEYVNKFVNG
TIGRATWTPAQSQRPRLIDHTGDDDAGPLGTNALSTLPPLEINSDEAMQLGYMPNRDSFE
REYDPTAEQLISNISLSSEDTEVDVMLKLAHVDIYTRRLRERARRKRMVRDYQLVSNFFR
NRNYAQQQGLTKEQREFRDRFRVYAQFYTCNEYERLLGSLEREKELRIRQSELYRYRYNG
LTKIAECTHFEQHAATATHRSTGPYGHGKTDHTHTSNGSHRPPSSSLHSPQPNLRKVEMS
SGGEASSNSIAPRNTLHIADPTCSGALLPSKNYLDSCRGSSAATMLQTTGMVMGVTVDSG
ATTGVTSTATTMANLPTNSAKGSQQHLQPLQQHPQLLQSGNQHKMQNEAAGGGSDQVPSM
SLKLRTQLEELKHLPQPPGSELLSHNELDLCKKHNITPTTYLSVKTVCLSGAPSLGSPME
TSLRKFFIKCGWLSH
Download sequence
Identical sequences Q8I8V0
FBpp0099776 7227.FBpp0099776 FBpp0081303 FBpp0099776 NP_001027151.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]