SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0100021 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0100021
Domain Number 1 Region: 51-142
Classification Level Classification E-value
Superfamily TPR-like 8.43e-18
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0100021   Gene: FBgn0036793   Transcript: FBtr0100566
Sequence length 357
Comment pep:known chromosome:BDGP5:3L:18593250:18611043:-1 gene:FBgn0036793 transcript:FBtr0100566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMHELTAVSKMKGPYFTSQYFSSQEFPRTNGVTRLRFSLNMLIHISIRNWSADECLMLG
LMYLFLKDYNQSENWLELALYHYDDNVSPEVLKIKLWNYPNLLESLVEANKGLGHYFEAK
KYANELLSINPNHTYMLTQLPKLKHLQSNPAKLTKPKKVFQLQKEICSKRYRRKSGVLVC
RYVDWTPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSRPKLQRIEHLSGNCSC
KIGNLSTSLHDVVRKVNELILGITGFPLKGNQMLEVINYGIAGNYNPEEPKIHNKANAFI
FLSNAGKGGEIVFPSRHLKVRPRKGSMLVWENLKKSLIYHQCPILKGNMWVANKVLN
Download sequence
Identical sequences Q8T0F2
FBpp0100021 FBpp0100021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]