SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110216 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110216
Domain Number 1 Region: 433-553
Classification Level Classification E-value
Superfamily EF-hand 6.02e-40
Family EF-hand modules in multidomain proteins 0.0000597
Further Details:      
 
Domain Number 2 Region: 554-658
Classification Level Classification E-value
Superfamily EF-hand 7.71e-33
Family EF-hand modules in multidomain proteins 0.0000769
Further Details:      
 
Domain Number 3 Region: 641-727
Classification Level Classification E-value
Superfamily RING/U-box 1.04e-23
Family ZZ domain 0.0066
Further Details:      
 
Domain Number 4 Region: 400-432
Classification Level Classification E-value
Superfamily WW domain 0.00000000163
Family WW domain 0.0014
Further Details:      
 
Domain Number 5 Region: 273-371
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000216
Family Spectrin repeat 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110216   Gene: FBgn0260003   Transcript: FBtr0110916
Sequence length 1051
Comment pep:known chromosome:BDGP5:3R:15394934:15421117:1 gene:FBgn0260003 transcript:FBtr0110916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFASSGQAATSPALAHSSSDEAGEVIENSHTKRAGCSVLQSSGGKSRSLERYSGAPKI
HQQTLEMLPPYATPTCSTRRRLLAPFRSLKRRSRSSSSSNESHHFGNHLNNLVVVNVGAA
AANGGVAKAKAKASSQSGDSGTGGTELEHEMEQDDDEEDEEEGEEMDELSLSYSQLSSSG
CEEAEAPPEDVPDDRQAAVEATVSACVQHVANERRRNILSLYSSSSEEQLHCRLGDITLV
DDTYSNYDPQNDAERMFLQVVGILRDENEKMRQFQKILEDLSSRVALAEQTKTSWLPPSS
VGEANEQMQQLQRLRDKMTTASALLDDCNEQQSFFTANQVLVPTPCLSKLEDLNTRMKLL
QIAMDERQKVLCQAGAQQTHENGDDGRTTSNSGTIGPLPNLGQSVKPPWERATTAANVPY
YIDHERETTHWDHPEMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACES
FDRHGLRAQNDKLIDIPDMTTVLHSLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRV
LSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGG
SNIEPSVRSCLEQAGISQEAIDGNQDISIELQHFLGWLQHEPQSLVWLPVLHRLAAAEAA
KHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTE
DVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTHQLQNDMHSR
LEMYASRLAQVEYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVMAAMDAE
QREELEAIIRDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQGEQGQD
MMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDEPNGGGSSATSSGLPSAPG
SALNSKPNTLQTRSVTASQLNTDSPAKMNQQNGHYEHNSKNSSGLVTVITEQELESINDD
LEDSSSSNTTNTTTTTTTTATTEKTCVELQK
Download sequence
Identical sequences Q7YU29
FBpp0110216 FBpp0110216 NP_001036727.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]