SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110217 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110217
Domain Number 1 Region: 31-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.74e-63
Family Calponin-homology domain, CH-domain 0.0000432
Further Details:      
 
Domain Number 2 Region: 2911-3031
Classification Level Classification E-value
Superfamily EF-hand 3.41e-39
Family EF-hand modules in multidomain proteins 0.0000597
Further Details:      
 
Domain Number 3 Region: 3032-3136
Classification Level Classification E-value
Superfamily EF-hand 3.4e-32
Family EF-hand modules in multidomain proteins 0.0000769
Further Details:      
 
Domain Number 4 Region: 3119-3205
Classification Level Classification E-value
Superfamily RING/U-box 4.35e-23
Family ZZ domain 0.0066
Further Details:      
 
Domain Number 5 Region: 2558-2686
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-18
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 6 Region: 2389-2505
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 7 Region: 2714-2849
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000256
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 8 Region: 460-557
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000017
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 2878-2910
Classification Level Classification E-value
Superfamily WW domain 0.00000000623
Family WW domain 0.0014
Further Details:      
 
Domain Number 10 Region: 1259-1398
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000123
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 11 Region: 1384-1514
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000317
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 12 Region: 344-449
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000602
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 13 Region: 1172-1272
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000129
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 14 Region: 523-649
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000633
Family Spectrin repeat 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0110217
Domain Number - Region: 2273-2397
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000734
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number - Region: 1096-1208
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00693
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number - Region: 1486-1614
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0695
Family Spectrin repeat 0.021
Further Details:      
 
Domain Number - Region: 2120-2190
Classification Level Classification E-value
Superfamily LemA-like 0.0941
Family LemA-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110217   Gene: FBgn0260003   Transcript: FBtr0110917
Sequence length 3529
Comment pep:known chromosome:BDGP5:3R:15286810:15421117:1 gene:FBgn0260003 transcript:FBtr0110917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHDPSDYDSVYSEEDFVDTVRGAATPPLMDYEEFRVKTMDERQHIQKKTFTKWINSHLID
TQCTPVKDLFLDLRDGHRLLALLSTLTQTNLKPEKGRMRVHHINNLNKVITEIQQHGVKL
VNISSDDIVGGNAKLTLGLIWLIALEFNGQHLVKSHSSNGVEKSLLAWARQYTEPHGLQL
NDFSSSWSDGRAFLMILDAHVEELNLQAALQQHALKRLHLAFDLAHRHFKIEKLLDAEDV
HTHKPDNKSIQMYVMCLYHAMESMRTRQQEQEQDEGQDQDPGRVPCTSITDLDEVPLDND
QTSLGLYTSDSAGSMEQRSSGELKTHSMRPLSTATNASVEISGYQSALEAVLTLLLEDEQ
LLSQNLPDPQDFQTAKLQFHENESFMLKLTEHQEYVGEALEEGSNLINESQKAGAGLSQE
DQNEVRQQMVLLNERWETLRLRALDVQAKILMRLAEFQKQKLEQLRQFLTSVEDRISHMS
DIGPTLEEAEKQLLEAQKLKADLSEQQELVDSLSSMVVIVNDTSGNFNDLEDRLSALGER
WSHVVKWSDLRKEKLQQYKCISRWLDAREQDLKLMESRDVTDVGGITQRINELNYCAKDL
LELQRYLIDLRQMVAATLQDGDDKGERVLIQLESYEDRLDALKQIVEVQTVRIETKGFNF
GRDRASYDDSRVVRPEGWVDYQMIIRFGEDDSQEDDDEHDLASKKRKLRNADNFNALENH
IMEHFGYVQEVEQKLQQLQRQSLRQQCELLKELQAENSRRCGTLPELKKLYEVCELEDPS
RNLLLEETHIKQLEQRYANLSQKLSSQQSESHTLLAKEKYYNSLTGFKLVLADSRDWYKQ
HAGSASGNELEQRLSHMESLASEISEAKTATEELDDNLIEWKQDFGLFYDSWHDMKQALQ
ALIQQRGGESLSRQLKQIQDFVTKVSNQKVRVSNLEVMQEQQHFLNQLLDEMESLRLTYD
NIPKHLIGEELQTAWNRLPEQLNERVIKQTTAIENLNHFAAEYNAIIAMLRSAADSKLNG
SDGASSQDLRKLEIDVISARNFSEILIKEAEPAQKESLQSQIRALNTLYDQVEQVHREKK
EQQTVLQSHIDLIQLRLKETDQWLTDLESNTPKSGISDIVNSNELFQSKSRFQTLKETCE
RETTQFRDLNERGGELLLQMDELQDQDRESRYGSLAKQFTRINARWTEVTELVYAKTALL
EHISTQLGEFKKFMVSETGYLDKLENKIRNTPENAADAEEIMEELDDLENVLRSHSEEWL
DKIQEIGNELIDNEFMADSIRRDIDETVQRWTQLQQQAKKRTELLEQKVSEAEQSEKCIV
QFEKWLTRVDDILSDHLDNDVTIVDQPEEFQRLAHEFVANEKNFKEISELIDEHTRNGKV
GAANRLQEQLNLMEVRFKYCQAKLSKCTAIQHSYESRLNRAYTDLRNVERSTEVVDVASA
GPNTVQTQYQKCLQIYRTLSEIKSEIESTIKTGRRVCEDRYTKSPKQLSQRIDALKHLYN
TLGENVTQSKATLERLLTLARQLEECFDSADNLIRRFESPQEVHDRNSILLEFEDVLRRC
EDHYNEYNKSCDQSCMVETRQRIDGLKATYHKLTSADIIKRLTEMKTTLQNLDNISLETL
RAMEHDLKEINVPSNPEIEKLQQQVIAIVVDVLKTRFNEATTLAARNTSSPDNDDTEIVV
VSDTVRQRRARTPQSGESPSSAHTSSSESPTKGVENSPGAVGDQVMPDLLPPQTFRLAES
STLFSQISLNPQKVTNTPPPKPAKTKRKAPSSPAQVVEIRVKNIQNDKMSVQNIDLEPQQ
GEIVDTVNILESVEPFVPEYVETVQIVDLSEDSDSSVRVDSQGKEMRRSKSKHSLNETPL
PKVSDNDEDSAEQEEDLLRPSAENTSTPFLRVEKRRISFDEKRKRVANERDILRDSEEEE
PKTPDTPRAAQVSKPKRWRQLQPEMDALEPESPGRDSFYSPDKESGFDAEPLVFSDDEDI
PRFSLEMTSTIDSDSDTSRIMTPSTKNPNPFLSKVLESLSSPVDDSNVTLKSPISEEQPQ
NLDDRVREFDKQAKQMIYKLKLTKAKIEQCHESEAEDLRLLIAPDAATLISQGDSLVLET
HGRQGSISRLVMRTQIILREQFREVQQARSKTSGSGAPAPPLDSVNIEELVTKGLRRINV
LIEKTVDLKSSTDLEKRMEDINERHDDLQVIVSAIGKNAQMPKVTPLMMNEIEKTKNNLI
AHADSIELSLTELRNGPRISNGKERPDASSAATMSCRSEYNNEPSGTGALAGSFDKSVLQ
ISDWLTWEQNMIKIQSVLVDDGDAVRLAIEKQEKVLRELKMKKPQLNELVHTAEVLKGDV
KRQQLQEKELKQFSLAPHCSADLDYMRCCLKVTRLREHWDETSQCVLQRAAQLKNMLSDS
QRFEAKRLELEKWLARMEQRAERMGTIATTADILEAQQKEQKSFHAELHQNKQHFDIFNE
LTQKLIAVYPNDDTTRIKKMTEVINQRYANLNSGVINRGKQLHAAVHSLQSFDRAMDQFL
AFLSETETLCENAESDIERNPLMFKDLQSEIETHRVVYDRLDGTGRKLLGSLTSQEDAVM
LQRRLDEMNQRWNNLKSKSIAIRNRLESNSEHWNALLLSLRELTEWVIRKDTELSTLGLG
PVRGDAVSLQKQLDDHKAFRRQLEDKRPIVESNLTSGRQYIANEAAVSDTSDTEANHDSD
SRYMSAEEQSRELTRSIRREVGKLSEQWNNLIDRSDNWKHRLDEYMTKMRQFQKILEDLS
SRVALAEQTKTSWLPPSSVGEANEQMQQLQRLRDKMTTASALLDDCNEQQSFFTANQVLV
PTPCLSKLEDLNTRMKLLQIAMDERQKVLCQAGAQQTHENGDDGRTTSNSGTIGPLPNLG
QSVKPPWERATTAANVPYYIDHERETTHWDHPEMIELMKGLADLNEIRFSAYRTAMKLRS
VQKRLALDRISMSTACESFDRHGLRAQNDKLIDIPDMTTVLHSLYVTIDKIDLTLMLDLA
INWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLL
HDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAGISQEAIDGNQDISIELQHFLGWLQHEP
QSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKN
HKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESP
APSPQHTTHQLQNDMHSRLEMYASRLAQVEYGGTGSNSTPDSDDEHQLIAQYCQALPGTS
NGSAPKSPVQVMAAMDAEQREELEAIIRDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQ
HSSSSMTGLSGQGEQGQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDE
PNGGGSSATSSGLPSAPGSALNSKPNTLQTRSVTASQLNTDSPAKMNQQNGHYEHNSKNS
SGLVTVITEQELESINDDLEDSSSSNTTNTTTTTTTTATTEKTCVELQK
Download sequence
Identical sequences NP_001036728.1.81976 FBpp0110217 FBpp0110217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]