SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110357 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110357
Domain Number 1 Region: 913-1118
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-44
Family Fibronectin type III 0.00018
Further Details:      
 
Domain Number 2 Region: 1118-1315
Classification Level Classification E-value
Superfamily Fibronectin type III 6.57e-37
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 3 Region: 1407-1584
Classification Level Classification E-value
Superfamily Fibronectin type III 6.75e-30
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 4 Region: 815-919
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 432-533
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 1326-1409
Classification Level Classification E-value
Superfamily Immunoglobulin 3.88e-20
Family I set domains 0.039
Further Details:      
 
Domain Number 7 Region: 340-425
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 8 Region: 717-819
Classification Level Classification E-value
Superfamily Immunoglobulin 2.44e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 9 Region: 533-624
Classification Level Classification E-value
Superfamily Immunoglobulin 5.35e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 10 Region: 596-716
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000105
Family I set domains 0.036
Further Details:      
 
Domain Number 11 Region: 265-346
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000256
Family I set domains 0.028
Further Details:      
 
Domain Number 12 Region: 38-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000649
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0110357
Domain Number - Region: 140-226
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00235
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110357   Gene: FBgn0033159   Transcript: FBtr0111064
Sequence length 2020
Comment pep:known chromosome:BDGP5:2R:3207059:3269374:-1 gene:FBgn0033159 transcript:FBtr0111064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIE
CKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLAR
NQFGSIISRDVHVRAVVSQFYITEAENEYVIKGNAAVVKCKIPSFVADFVQVEAWVDEEG
MELWRNNATDAYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
ITEPVGTVSPKISTGEDFKHLKGKSSQDLSILCPAQAYPQPFFRWYKFIEGTTRKQAVVL
NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF
GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA
SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ
VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA
IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
VAKNQEGYSARGSLEVQVMVAPKIAPFDFGDEPSNFGESASVQCLVTSGDFPVSFAWLFN
GREINENVYDVSMVKLGKKISALSIDIVRDHHAGNYTCVAVNRATSVNFTAELVVNVPPR
WILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLH
VDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAK
GEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAF
GSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS
EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI
KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE
LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV
SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA
GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG
AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA
SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD
AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT
LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK
PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV
VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPSRDLPELSAEDTIRIILSN
LNLVVPVVAALLVIIIAIIVICILRSKGNHHKDDVVYNQTMGPGATLDKRRPDLRDELGY
IAPPNRKLPPVPGSNYNTCDRIKRGRGGLRSNHSTWDPRRNPNLYEELKAPPVPMHGNHY
GHAHGNAECHYRHPGMEDEICPYATFHLLGFREEMDPTKAMNFQTFPHQNGHAGPVPGHA
GTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTPAPEYDDPANCAEEDQYRR
YTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPYDHYGSRGSMGRRSIGS
ARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDRDHGPRGNYGAVKRSPQPK
DQRTTEEMRKLIERNETGPKQLQLQQANGAGFTAYDTMAV
Download sequence
Identical sequences Q0E9L1
NP_001036488.1.81976 FBpp0110357 FBpp0110357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]