SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110360 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110360
Domain Number 1 Region: 911-1116
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-44
Family Fibronectin type III 0.00018
Further Details:      
 
Domain Number 2 Region: 1116-1313
Classification Level Classification E-value
Superfamily Fibronectin type III 6.57e-37
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 3 Region: 1405-1582
Classification Level Classification E-value
Superfamily Fibronectin type III 6.75e-30
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 4 Region: 813-917
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 431-532
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 1324-1407
Classification Level Classification E-value
Superfamily Immunoglobulin 3.87e-20
Family I set domains 0.039
Further Details:      
 
Domain Number 7 Region: 339-424
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 8 Region: 715-817
Classification Level Classification E-value
Superfamily Immunoglobulin 2.44e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 9 Region: 532-622
Classification Level Classification E-value
Superfamily Immunoglobulin 3.43e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 10 Region: 634-723
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000121
Family I set domains 0.014
Further Details:      
 
Domain Number 11 Region: 248-345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000129
Family I set domains 0.025
Further Details:      
 
Domain Number 12 Region: 38-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000649
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0110360
Domain Number - Region: 140-226
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00234
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110360   Gene: FBgn0033159   Transcript: FBtr0111066
Sequence length 2018
Comment pep:known chromosome:BDGP5:2R:3207059:3269374:-1 gene:FBgn0033159 transcript:FBtr0111066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIE
CKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLAR
NQFGSIISRDVHVRAVVSQFYITEAENEYVIKGNAAVVKCKIPSFVADFVQVEAWVDEEG
MELWRNNATDAYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
ITEPIGSVAPTISGDRLQEQTRKLGHSFSILCQGQAYPHPVFRWYKFIEGTTRKQAVVLN
DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG
RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS
AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV
GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI
VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
AKNQEGYSARGSLEVQVMAPPKLAPFDFGDSPANFEDSVSVSCLVSSGDLPIDIEWLFNG
ESISYASGIAVLRGGKRTSVLTIDSVHAGHAGNYSCKAKNKAASSEYSAALIVNVPPRWI
LEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD
NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGE
KPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGS
DDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEI
DRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKV
EPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQ
NLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSP
PLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGG
DGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAE
TETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASF
DDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAG
DYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLH
YKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPK
LPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVL
DLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPSRDLPELSAEDTIRIILSNLN
LVVPVVAALLVIIIAIIVICILRSKGNHHKDDVVYNQTMGPGATLDKRRPDLRDELGYIA
PPNRKLPPVPGSNYNTCDRIKRGRGGLRSNHSTWDPRRNPNLYEELKAPPVPMHGNHYGH
AHGNAECHYRHPGMEDEICPYATFHLLGFREEMDPTKAMNFQTFPHQNGHAGPVPGHAGT
MLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTPAPEYDDPANCAEEDQYRRYT
RVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPYDHYGSRGSMGRRSIGSAR
NPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDRDHGPRGNYGAVKRSPQPKDQ
RTTEEMRKLIERNETGPKQLQLQQANGAGFTAYDTMAV
Download sequence
Identical sequences Q0E9L4
NP_001036486.1.81976 FBpp0110360 FBpp0110360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]