SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110370 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110370
Domain Number 1 Region: 908-1113
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-44
Family Fibronectin type III 0.00018
Further Details:      
 
Domain Number 2 Region: 1113-1310
Classification Level Classification E-value
Superfamily Fibronectin type III 6.65e-37
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 3 Region: 1402-1579
Classification Level Classification E-value
Superfamily Fibronectin type III 6.83e-30
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 4 Region: 810-914
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 429-530
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 1321-1404
Classification Level Classification E-value
Superfamily Immunoglobulin 3.88e-20
Family I set domains 0.039
Further Details:      
 
Domain Number 7 Region: 615-717
Classification Level Classification E-value
Superfamily Immunoglobulin 8.35e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 8 Region: 337-422
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 9 Region: 530-621
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 10 Region: 253-343
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-16
Family I set domains 0.042
Further Details:      
 
Domain Number 11 Region: 710-814
Classification Level Classification E-value
Superfamily Immunoglobulin 2.46e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 12 Region: 38-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000673
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0110370
Domain Number - Region: 147-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000388
Family I set domains 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110370   Gene: FBgn0033159   Transcript: FBtr0111076
Sequence length 2030
Comment pep:known chromosome:BDGP5:2R:3207059:3269374:-1 gene:FBgn0033159 transcript:FBtr0111076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIE
CKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLAR
NQFGSIISRDVHVRAVVNQFYEAEIMTEYVIRGNAAVLKCSIPSFVADFVRVESWIDDEG
NVLSFSDNYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE
PVGRVSPKFPNTLTSSSFTGDEGSSQTLLCPAQAYPAPLFRWYKFIEGTTRKQAVVLNDR
VKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRP
AVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAE
LKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQ
YVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVA
GETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAK
NQEGYSARGSLEVQVMVPPKLAPLPVNSPLYVGDYYQLTCAVVHGDAPFNITWYYNNEPA
GDLAGVTILMHGRRSSSLNIESVGGDHAGNYTCKGANRAGETTAETHLSVKVPPRWILEP
TDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQ
KTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPI
GILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDA
SINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEIDRV
IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV
NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLR
VYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLE
SANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGV
RSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETET
KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDT
FTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYS
CHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKP
EFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPE
KPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLE
PATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPLDDGSGHGNVHTRIRLPAWMPEWL
DLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDKR
RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGRGGLRSNHSTWDPRRNPNLYEELKA
PPVPMHGNHYGHAHGNAECHYRHPGMEDEICPYATFHLLGFREEMDPTKAMNFQTFPHQN
GHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTPAPEYDDPA
NCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPYDHYGSR
GSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDRDHGPRGNY
GAVKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANGAGFTAYDTMAV
Download sequence
Identical sequences Q0E9K1
NP_001036478.1.81976 FBpp0110370 FBpp0110370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]