SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110374 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110374
Domain Number 1 Region: 913-1118
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-44
Family Fibronectin type III 0.00018
Further Details:      
 
Domain Number 2 Region: 1118-1315
Classification Level Classification E-value
Superfamily Fibronectin type III 6.65e-37
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 3 Region: 1407-1584
Classification Level Classification E-value
Superfamily Fibronectin type III 6.83e-30
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 4 Region: 815-919
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 432-533
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 1326-1409
Classification Level Classification E-value
Superfamily Immunoglobulin 4.05e-20
Family I set domains 0.039
Further Details:      
 
Domain Number 7 Region: 596-716
Classification Level Classification E-value
Superfamily Immunoglobulin 9.38e-17
Family I set domains 0.031
Further Details:      
 
Domain Number 8 Region: 340-425
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 9 Region: 533-624
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 10 Region: 715-819
Classification Level Classification E-value
Superfamily Immunoglobulin 2.81e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 11 Region: 266-346
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000256
Family I set domains 0.034
Further Details:      
 
Domain Number 12 Region: 38-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000295
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0110374
Domain Number - Region: 114-226
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000338
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110374   Gene: FBgn0033159   Transcript: FBtr0111080
Sequence length 2035
Comment pep:known chromosome:BDGP5:2R:3207059:3269374:-1 gene:FBgn0033159 transcript:FBtr0111080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIE
CKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLAR
NQFGSIISRDVHVRAVVPQSYTVNVMDESILRGNSAILKCHIPSFVADFIVVDSWVEDEE
RVIYPQEDIAESDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
ITEPIGSVAPRVNRKDEFNHDRIKSSKTISIQCPAQAFPVPVYRWYKFIEGTTRKQAVVL
NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF
GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA
SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ
VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA
IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
VAKNQEGYSARGSLEVQVMVPPHVLPFSFGSEVFNMGDVLSITCVVLKGDLPLRIHWTLN
GEPVATGVNGFTVMQLNQRTTYLSVDALEAKHRGSYSCVAQNQAGEAIYSADLQVNVPPR
WILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLH
VDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAK
GEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAF
GSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS
EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI
KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE
LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV
SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA
GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG
AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA
SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD
AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT
LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK
PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV
VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPLDDGSGHGNVHTRIRLPAW
MPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGA
TLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGRGGLRSNHSTWDPRRNPNLY
EELKAPPVPMHGNHYGHAHGNAECHYRHPGMEDEICPYATFHLLGFREEMDPTKAMNFQT
FPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTPAPE
YDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPYD
HYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDRDHG
PRGNYGAVKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANGAGFTAYDTMAV
Download sequence
Identical sequences Q0E9M4
NP_001036476.1.81976 FBpp0110374 FBpp0110374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]