SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110389 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110389
Domain Number 1 Region: 910-1115
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-44
Family Fibronectin type III 0.00018
Further Details:      
 
Domain Number 2 Region: 1115-1312
Classification Level Classification E-value
Superfamily Fibronectin type III 6.65e-37
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 3 Region: 1404-1581
Classification Level Classification E-value
Superfamily Fibronectin type III 6.83e-30
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 4 Region: 812-916
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 429-530
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 1323-1406
Classification Level Classification E-value
Superfamily Immunoglobulin 3.88e-20
Family I set domains 0.039
Further Details:      
 
Domain Number 7 Region: 711-816
Classification Level Classification E-value
Superfamily Immunoglobulin 1.58e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 337-422
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 9 Region: 530-621
Classification Level Classification E-value
Superfamily Immunoglobulin 6.21e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 10 Region: 260-343
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000238
Family I set domains 0.031
Further Details:      
 
Domain Number 11 Region: 593-713
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000179
Family V set domains (antibody variable domain-like) 0.073
Further Details:      
 
Domain Number 12 Region: 38-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000553
Family I set domains 0.016
Further Details:      
 
Domain Number 13 Region: 146-227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000409
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110389   Gene: FBgn0033159   Transcript: FBtr0111094
Sequence length 2032
Comment pep:known chromosome:BDGP5:2R:3207059:3269374:-1 gene:FBgn0033159 transcript:FBtr0111094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIE
CKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLAR
NQFGSIISRDVHVRAVVAQYYDTDVNKAYVIRGNAAVLKCEIPSFVADFVSVVSWHTDQN
EDFLPGSEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE
PVGSVAPKVNKNDEFSHDRIAIGGMVALRCPAQSFPVPVYRWYKFIEGTTRKQAVVLNDR
VKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRP
AVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAE
LKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQ
YVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVA
GETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAK
NQEGYSARGSLEVQVMVAPQISPFSFGDEPLNRGEVASVNCVVPKGDLPLDIYWTLNSAL
IVNGEMGFTLVRLNKRTSSLNVDSLEAVHRGSYKCIANNSAGYAEYVSTLDVNVPPRWIL
EPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDN
IQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEK
PIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSD
DASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEID
RVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVE
PVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQN
LRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPP
LESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGD
GVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAET
ETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFD
DTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGD
YSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHY
KPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKL
PEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLD
LEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPLDDGSGHGNVHTRIRLPAWMPE
WLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLD
KRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGRGGLRSNHSTWDPRRNPNLYEEL
KAPPVPMHGNHYGHAHGNAECHYRHPGMEDEICPYATFHLLGFREEMDPTKAMNFQTFPH
QNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTPAPEYDD
PANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPYDHYG
SRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDRDHGPRG
NYGAVKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANGAGFTAYDTMAV
Download sequence
Identical sequences Q0E9I6
FBpp0110389 FBpp0110389 NP_001036500.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]