SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110392 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110392
Domain Number 1 Region: 912-1117
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-44
Family Fibronectin type III 0.00018
Further Details:      
 
Domain Number 2 Region: 1117-1314
Classification Level Classification E-value
Superfamily Fibronectin type III 6.57e-37
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 3 Region: 1406-1583
Classification Level Classification E-value
Superfamily Fibronectin type III 6.75e-30
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 4 Region: 814-918
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 432-533
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 1325-1408
Classification Level Classification E-value
Superfamily Immunoglobulin 3.88e-20
Family I set domains 0.039
Further Details:      
 
Domain Number 7 Region: 643-724
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-16
Family I set domains 0.032
Further Details:      
 
Domain Number 8 Region: 340-425
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 9 Region: 714-818
Classification Level Classification E-value
Superfamily Immunoglobulin 2.63e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 10 Region: 533-624
Classification Level Classification E-value
Superfamily Immunoglobulin 7.71e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 11 Region: 266-346
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000883
Family I set domains 0.022
Further Details:      
 
Domain Number 12 Region: 38-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000625
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0110392
Domain Number - Region: 143-226
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000102
Family I set domains 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110392   Gene: FBgn0033159   Transcript: FBtr0111097
Sequence length 2019
Comment pep:known chromosome:BDGP5:2R:3207059:3269374:-1 gene:FBgn0033159 transcript:FBtr0111097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIE
CKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLAR
NQFGSIISRDVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEG
QLYGSLGDQQGTDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
ITEPISSAVPKVVSLAKFDMKTYSGSSTMALLCPAQGYPVPVFRWYKFIEGTTRKQAVVL
NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF
GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA
SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ
VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA
IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
VAKNQEGYSARGSLEVQVMVLPQIMPFDFGEDVINELDMVSAYCTVNRGDLPVDIAWTKN
GGRIYTNDGLIVTRNSQRISVLSIESVRARHAGNYSCVATNSAGETRQSAILAVNVPPRW
ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV
DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG
EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG
SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSE
IDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIK
VEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLEL
QNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVS
PPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAG
GDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGA
ETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIAS
FDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDA
GDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTL
HYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKP
KLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVV
LDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPSRDLPELSAEDTIRIILSNL
NLVVPVVAALLVIIIAIIVICILRSKGNHHKDDVVYNQTMGPGATLDKRRPDLRDELGYI
APPNRKLPPVPGSNYNTCDRIKRGRGGLRSNHSTWDPRRNPNLYEELKAPPVPMHGNHYG
HAHGNAECHYRHPGMEDEICPYATFHLLGFREEMDPTKAMNFQTFPHQNGHAGPVPGHAG
TMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTPAPEYDDPANCAEEDQYRRY
TRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPYDHYGSRGSMGRRSIGSA
RNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDRDHGPRGNYGAVKRSPQPKD
QRTTEEMRKLIERNETGPKQLQLQQANGAGFTAYDTMAV
Download sequence
Identical sequences Q0E9I8
FBpp0110392 NP_001036521.1.81976 FBpp0110392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]