SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0110415 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110415
Domain Number 1 Region: 469-517
Classification Level Classification E-value
Superfamily RING/U-box 0.0000406
Family RING finger domain, C3HC4 0.054
Further Details:      
 
Domain Number 2 Region: 200-418
Classification Level Classification E-value
Superfamily ARM repeat 0.0000863
Family Clathrin heavy chain proximal leg segment 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110415   Gene: FBgn0002566   Transcript: FBtr0111123
Sequence length 528
Comment pep:known chromosome:BDGP5:2L:22817527:22833259:1 gene:FBgn0002566 transcript:FBtr0111123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNSEEICTDSLTLRGFEEYTVNDYSLGGIIEENRFYIVAPKDIVVASLIETDDRIEWLI
KHSKFEEAMELISANGGNVPVLSVAKLYINHLLALKKYDDAAKLCLRMLGNDKVLWEEEV
FKFVKCQQLRSVSAYLPTSDECKLDPHVYEMVLYEFLKFDVCGFLNLIKEWPSHLYDGLA
VINAIHDNFRKHYANQLLESLALLYSYQGDFESALRMYLKLQNKDVFQLIRRYELYDVIS
KLIIPLIQLDRDCAFEILLDKKKIKTEIVVHQLEHNQEYLYWYLDSLLKKDPSNVFQKKL
ISLYAIFDRNKLLPFLKRSKDYDIQEALVICKQENFYPEIVYLLGCMGGVEASEALNIII
HRIRDIEMAIEFCKEHDDSDLWNALINEFSKHPEIVTKVLDGIVDYFSPAVVVGKIKMGQ
NIPNLRQSLIKMLRHYNLQGEILSSAQQIQLNDYFEIHSEIVTTQRRGQQVSYEQLCSLC
HRPVLMAGTHLYCIIRLECGHVYHKPCIQGELLKNCNECNLWKLTVGK
Download sequence
Identical sequences Q8MT46
FBpp0110415 FBpp0110415 NP_001036417.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]