SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111404 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111404
Domain Number 1 Region: 78-271
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.35e-18
Family Eukaryotic proteases 0.015
Further Details:      
 
Weak hits

Sequence:  FBpp0111404
Domain Number - Region: 7-45
Classification Level Classification E-value
Superfamily RING/U-box 0.0279
Family ZZ domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111404   Gene: FBgn0085324   Transcript: FBtr0112491
Sequence length 288
Comment pep:known chromosome:BDGP5:3R:24615339:24616205:1 gene:FBgn0085324 transcript:FBtr0112491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLLVCVSALWFCQLCEAAIGAQLCKDCRVNVIYPSGGRGNHQLSENRQIVRIINKYKP
IRRQELEYQNEIGMSHLQFSFIAKIKVGNAVRCSAALVAPSLAITSSKCFSNDSFKPLQI
IFTGGRTIAVDNVVKADFCPELSILHLKRPSEINPIALCQYDVPLGTRVSMMMATSDLRY
YGRRRTEIISNRACKTTFLEEDSVFITPSMLCAKNSMNPEMCATSPGDVLLIDHQLCGLN
VYGFRCFQNALNGDLYISLGKLQPMIGDLIRKLNGLSEEFKSVTGKET
Download sequence
Identical sequences A8JRF1
NP_001097956.1.81976 FBpp0111404 7227.FBpp0111404 FBpp0111404 FBpp0111404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]