SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111417 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111417
Domain Number 1 Region: 33-81
Classification Level Classification E-value
Superfamily RING/U-box 4.57e-16
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111417   Gene: FBgn0085337   Transcript: FBtr0112504
Sequence length 108
Comment pep:known chromosome:BDGP5:3R:8915021:8915805:1 gene:FBgn0085337 transcript:FBtr0112504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQIMNSKDKRNPNYSGGNSGEEEDSWMNSYYTCLVCMQTAESPRVSFCGHHFCSQCIYN
WIRSQKYQAKCPYCQSLIGENTLITITMRRRRTYFRANPLWSTAARCA
Download sequence
Identical sequences A1A749
7227.FBpp0111417 FBpp0111417 FBpp0111417 FBpp0111417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]