SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111543 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111543
Domain Number 1 Region: 816-1002
Classification Level Classification E-value
Superfamily Bet v1-like 8.52e-46
Family STAR domain 0.00000283
Further Details:      
 
Domain Number 2 Region: 561-776
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.12e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00063
Further Details:      
 
Domain Number 3 Region: 33-109
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.97e-33
Family Variant SAM domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111543   Gene: FBgn0086901   Transcript: FBtr0112631
Sequence length 1017
Comment pep:known chromosome:BDGP5:3R:10217402:10231164:-1 gene:FBgn0086901 transcript:FBtr0112631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRRMSITIREYKFFRSFSQKFENWPKRKAEALWRKMRERKIAEIEAVEACKWLRAAGFP
QYAQMYEDHQFPIDLNNVAKDHTNLENDQLQSLYRRLCVLNRCATMRLDQSHKPQTPQQK
EESDDENFALSEHWTFQPHIRRWSRIGEMGLELPPPGLLSLNVEKTESSSKESSPDRFEE
DGAGITLVTPGCSKAGGIPNDGSSLGEGSDSGRLRRSGSERIKDQAKALLRRVESIKSRR
RKRQNRENVVISGPTVLDLSQFGQRSSLRKPDAVYSTPPSPSALSPMHTFPKAPFFGNDL
KVPSHSDNFLSPNRSSPKRTPTTPRSMRTSPLHFFSSPMSQLKEGKSDDSSSYYSDSQES
STGGKLSLRKPSKARRFLQRTGKVDDIGAHSDSECHQGRKLLIKDANSNTTEVKVKKLTR
GGSLNLGKDPKKRDGFRSSSFRSRSTSRKEAKNDEDTAGATTNGGSKRQPVVRWHSFQME
ERPNMIFRKCFSKKIEPLQEDAGGMPFAAMSAGQLQIIRKLALVTLTGHMERYCPSHRSG
WNWELPKFIKKIKMPDYKDKKVFGVPLLMILQRSGQTLPLAVRAAFRWLQLNALDQVGIF
RKSGGKSRIMKLREQIEVTDSTAECMDVFDLQQAYDVADMLKQYFRELPESLLTTKMSET
FVAIFQHLPAEVRLDAVQCAVLLLPDENREILYVLLEFLTIVAANSQQNQMTSNNLGVCL
AQSIFHSSISTGSASVSASPRRKGKGSGMPDMKELAEAKASHECLSFMIEHYKQIYTAAK
EKLSKCNFSYMEESKPLPLEALGEGMQFHNWRGYLYECTSATIKEGREKTRGWFSINSLN
DSSVDIAYKKVGDGHPLRLWRCSTEIEGPPKEVLEFVIKQRASWDTNLLQCQTVKKLDDR
TEIYQYALDGQLTTDFCVLRSWQTDLPRGACVIVETSIDHAKAKPLFGAVRGVVLASRYL
IEPCGSGRSRVMHLARVDVKGKTPEWYNKNYGHICSHYLSRIRLAFKHVADGPESKV
Download sequence
Identical sequences Q9VFK2
NP_731907.1.81976 FBpp0111543 FBpp0111543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]