SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111544 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111544
Domain Number 1 Region: 2150-2336
Classification Level Classification E-value
Superfamily Bet v1-like 2.75e-45
Family STAR domain 0.00000283
Further Details:      
 
Domain Number 2 Region: 1895-2110
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00063
Further Details:      
 
Domain Number 3 Region: 1373-1443
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.75e-31
Family Variant SAM domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111544   Gene: FBgn0086901   Transcript: FBtr0112632
Sequence length 2351
Comment pep:known chromosome:BDGP5:3R:10217402:10307410:-1 gene:FBgn0086901 transcript:FBtr0112632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNARELALIEKWADIATPATPNRPTLSPTSPPALHRSIVKFCCCPQRRRYNLKQAKSHG
GSNKLNVNTLHARNIFVDSDFSYIDDVPRRRQDCHSDYDDCNYDSDCGGDKADDEANDIA
AAPRDDGNVALILMNQRNLSEQWRQDNKGNSNSNKAATKTCAVTKSPQSGNEQQQHQQQQ
QQQQQQRQPTQRLSNSLQQQQQQEQQLQQQQQQQHSNKENTLSYDNNNKPHCNYCKLPDT
AEPQTNSNSNSKIDSPKSSQNKMTITTATDTETATATTATATGECGLPAATSQEFVGAAT
EVLCNDKATLTAATPAATATTAATTPKPRIAARPTTPSRLKTVIKTTMVKRSPSHDSTAT
AAHVLLPHSCSSNSNSSSNNIGAHDEPRRSVRERIAAFAAGNEQQQAARQHDKVKKLTKM
QCNSNTNQNNMTAEDVKSAISNSSSSSSNQLQQQQHQTLINGQAATVPAATAAATGGVAA
ATSGRTSAIAADTTRYKSGLSDVAANGDVDGRPTSSATTSVVATGAPSVFSTGCATMPRT
RQYGSNVAAALATGATLATSATSATSSATGATSPGSHTMTADKKFLSQAAPVQGHHHHKL
QFADKADSELAALDNLDLAHSLDLLDVDGEDPYGALQDYLERVKREINEVFELRKVQRLE
QQLREQLEERLSQAGVQQLDELSRSTESDSGFDSSSTTATSGTPATATAAGAGAVTSGKP
VTTKLRALPPPPLSPTKTTTNSMPTPPVQADDVNIWACKFLRDLDSLMAAGDKLPPHLAA
LAEGSGSGSASSSPTSRTAPILLSAAASAAIQSRLGKGSSSIMEHQLQQQQQQQNGLVLK
PEKHATIPLQSFYLDCGRNEASPATKSNVAYMRTLSAPNGGFASGGGGGAARGSGAPALP
PQSQRKSLACPPLNGQADTITPTPATHKLTNFQSALKIEEMAAAKGTAMATGESQLATTI
EDLKSRRQRQLSGGDMETMLASQPMSMPKRVGINHAVLTSRNAITPPPASASSASQSAAS
VHSAKGSSSAGTTPGYLVDVTKKGSTSTIWTSEESILRSVGAVDEDNNSTSSSSACEEAT
GVLSSGKSGISLDSSGLDNDNNESGIGTATPPKDMSHYWKSHHLQHHHHHHHRKCTGSAQ
DNESVSSLEALRKMKFQKSGSVASSDDPDVLEVLSQCGSGGEANESQDDMLDEEKDKMSK
SQDYDEIWDCDCTDGDASSASGGGGVTATPVILRRKYTAPPPILVPRTQRSHSLDHYHSP
QPLVHPRKVLPIHHHALKSKERGQLSLVLRQEPFQSLLSPSATAANQLHHFVELPSPSSA
SLHSGLGDSGGIQELCTKSNSAPMLLKEREMSRRFDNFEAQHLTLRYSRSQSDRYLAEIE
AVEACKWLRAAGFPQYAQMYEDHQFPIDLNNVAKDHTNLENDQLQSLYRRLCVLNRCATM
RLDQSHKPQTPQQKEESDDENFALSEHWTFQPHIRRWSRIGEMGLELPPPGLLSLNVEKT
ESSSKESSPDRFEEDGAGITLVTPGCSKAGGIPNDGSSLGEGSDSGRLRRSGSERIKDQA
KALLRRVESIKSRRRKRQNRENVVISGPTVLDLSQFGQRSSLRKPDAVYSTPPSPSALSP
MHTFPKAPFFGNDLKVPSHSDNFLSPNRSSPKRTPTTPRSMRTSPLHFFSSPMSQLKEGK
SDDSSSYYSDSQESSTGGKLSLRKPSKARRFLQRTGKVDDIGAHSDSECHQGRKLLIKDA
NSNTTEVKVKKLTRGGSLNLGKDPKKRDGFRSSSFRSRSTSRKEAKNDEDTAGATTNGGS
KRQPVVRWHSFQMEERPNMIFRKCFSKKIEPLQEDAGGMPFAAMSAGQLQIIRKLALVTL
TGHMERYCPSHRSGWNWELPKFIKKIKMPDYKDKKVFGVPLLMILQRSGQTLPLAVRAAF
RWLQLNALDQVGIFRKSGGKSRIMKLREQIEVTDSTAECMDVFDLQQAYDVADMLKQYFR
ELPESLLTTKMSETFVAIFQHLPAEVRLDAVQCAVLLLPDENREILYVLLEFLTIVAANS
QQNQMTSNNLGVCLAQSIFHSSISTGSASVSASPRRKGKGSGMPDMKELAEAKASHECLS
FMIEHYKQIYTAAKEKLSKCNFSYMEESKPLPLEALGEGMQFHNWRGYLYECTSATIKEG
REKTRGWFSINSLNDSSVDIAYKKVGDGHPLRLWRCSTEIEGPPKEVLEFVIKQRASWDT
NLLQCQTVKKLDDRTEIYQYALDGQLTTDFCVLRSWQTDLPRGACVIVETSIDHAKAKPL
FGAVRGVVLASRYLIEPCGSGRSRVMHLARVDVKGKTPEWYNKNYGHICSHYLSRIRLAF
KHVADGPESKV
Download sequence
Identical sequences A8JR05
7227.FBpp0111544 FBpp0111542 FBpp0111544 NP_001097786.1.81976 NP_001097788.1.81976 FBpp0111542 FBpp0111544 FBpp0111542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]